KEGG   Homo sapiens (human): 222545Help
Entry
222545            CDS       T01001                                 

Gene name
GPRC6A, GPCR, bA86F4.3
Definition
(RefSeq) G protein-coupled receptor class C group 6 member A
  KO
K04622  
G protein-coupled receptor family C group 6 member A
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Other
   Orphan GPCR6
    222545 (GPRC6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q22.1
AA seq 926 aa AA seqDB search
MAFLIILITCFVIILATSQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQI
QECVGFEISVFLQTLAMIHSIEMINNSTLLPGVKLGYEIYDTCTEVTVAMAATLRFLSKF
NCSRETVEFKCDYSSYMPRVKAVIGSGYSEITMAVSRMLNLQLMPQVGYESTAEILSDKI
RFPSFLRTVPSDFHQIKAMAHLIQKSGWNWIGIITTDDDYGRLALNTFIIQAEANNVCIA
FKEVLPAFLSDNTIEVRINRTLKKIILEAQVNVIVVFLRQFHVFDLFNKAIEMNINKMWI
ASDNWSTATKITTIPNVKKIGKVVGFAFRRGNISSFHSFLQNLHLLPSDSHKLLHEYAMH
LSACAYVKDTDLSQCIFNHSQRTLAYKANKAIERNFVMRNDFLWDYAEPGLIHSIQLAVF
ALGYAIRDLCQARDCQNPNAFQPWELLGVLKNVTFTDGWNSFHFDAHGDLNTGYDVVLWK
EINGHMTVTKMAEYDLQNDVFIIPDQETKNEFRNLKQIQSKCSKECSPGQMKKTTRSQHI
CCYECQNCPENHYTNQTDMPHCLLCNNKTHWAPVRSTMCFEKEVEYLNWNDSLAILLLIL
SLLGIIFVLVVGIIFTRNLNTPVVKSSGGLRVCYVILLCHFLNFASTSFFIGEPQDFTCK
TRQTMFGVSFTLCISCILTKSLKILLAFSFDPKLQKFLKCLYRPILIIFTCTGIQVVICT
LWLIFAAPTVEVNVSLPRVIILECEEGSILAFGTMLGYIAILAFICFIFAFKGKYENYNE
AKFITFGMLIYFIAWITFIPIYATTFGKYVPAVEIIVILISNYGILYCTFIPKCYVIICK
QEINTKSAFLKMIYSYSSHSVSSIALSPASLDSMSGNVTMTNPSSSGKSATWQKSKDLQA
QAFAHICRENATSVSKTLPRKRMSSI
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggcattcttaattatactaattacctgctttgtgattattcttgctacttcacagcct
tgccagacccctgatgactttgtggctgccacttctccgggacatatcataattggaggt
ttgtttgctattcatgaaaaaatgttgtcctcagaagactctcccagacgaccacaaatc
caggagtgtgttggctttgaaatatcagtttttcttcaaactcttgccatgatacacagc
attgagatgatcaacaattcaacactcttacctggagtcaaactggggtatgaaatctat
gacacttgtacagaagtcacagtggcaatggcagccactctgaggtttctttctaaattc
aactgctccagagaaactgtggagtttaagtgtgactattccagctacatgccaagagtt
aaggctgtcataggttctgggtactcagaaataactatggctgtctccaggatgttgaat
ttacagctcatgccacaggtgggttatgaatcaactgcagaaatcctgagtgacaaaatt
cgctttccttcatttttacggactgtgcccagtgacttccatcaaattaaagcaatggct
cacctgattcagaaatctggttggaactggattggcatcataaccacagatgatgactat
ggacgattggctcttaacacttttataattcaggctgaagcaaataacgtgtgcatagcc
ttcaaagaggttcttccagcctttctttcagataataccattgaagtcagaatcaatcgg
acactgaagaaaatcattttagaagcccaggttaatgtcattgtggtatttctgaggcaa
ttccatgtttttgatctcttcaataaagccattgaaatgaatataaataagatgtggatt
gctagtgataattggtcaactgccaccaagattaccaccattcctaatgttaaaaagatt
ggcaaagttgtagggtttgcctttagaagagggaatatatcctctttccattcctttctt
caaaatctgcacttgcttcccagtgacagtcacaaactcttacatgaatatgccatgcat
ttatctgcctgcgcatatgtcaaggacactgatttgagtcaatgcatattcaatcattct
caaaggactttggcctacaaggctaacaaggctatagaaaggaacttcgtcatgagaaat
gacttcctctgggactatgctgagccaggactcattcatagtattcagcttgcagtgttt
gcccttggttatgccattcgggatctgtgtcaagctcgtgactgtcagaaccccaacgcc
tttcaaccatgggagttacttggtgtgctaaaaaatgtgacattcactgatggatggaat
tcatttcattttgatgctcacggggatttaaatactggatatgatgttgtgctctggaag
gagatcaatggacacatgactgtcactaagatggcagaatatgacctacagaatgatgtc
ttcatcatcccagatcaggaaacaaaaaatgagttcaggaatcttaagcaaattcaatct
aaatgctccaaggaatgcagtcctgggcaaatgaagaaaactacaagaagtcaacacatc
tgttgctatgaatgtcagaactgtcctgaaaatcattacactaatcagacagatatgcct
cactgccttttatgcaacaacaaaactcactgggcccctgttaggagcactatgtgcttt
gaaaaggaagtggaatatctcaactggaatgactccttggccatcctactcctgattctc
tccctactgggaatcatatttgttctggttgttggcataatatttacaagaaacctgaac
acacctgttgtgaaatcatccgggggattaagagtctgctatgtgatccttctctgtcat
ttcctcaattttgccagcacgagctttttcattggagaaccacaagacttcacatgtaaa
accaggcagacaatgtttggagtgagctttactctttgcatctcctgcattttgacgaag
tctctgaaaattttgctagccttcagctttgatcccaaattacagaaatttctgaagtgc
ctctatagaccgatccttattatcttcacttgcacgggcatccaggttgtcatttgcaca
ctctggctaatctttgcagcacctactgtagaggtgaatgtctccttgcccagagtcatc
atcctggagtgtgaggagggatccatacttgcatttggcaccatgctgggctacattgcc
atcctggccttcatttgcttcatatttgctttcaaaggcaaatatgagaattacaatgaa
gccaaattcattacatttggcatgctcatttacttcatagcttggatcacattcatccct
atctatgctaccacatttggcaaatatgtaccagctgtggagattattgtcatattaata
tctaactatggaatcctgtattgcacattcatccccaaatgctatgttattatttgtaag
caagagattaacacaaagtctgcctttctcaagatgatctacagttattcttcccatagt
gtgagcagcattgccctgagtcctgcttcactggactccatgagcggcaatgtcacaatg
accaatcccagctctagtggcaagtctgcaacctggcagaaaagcaaagatcttcaggca
caagcatttgcacacatatgcagggaaaatgccacaagtgtatctaaaactttgcctcga
aaaagaatgtcaagtatatga

DBGET integrated database retrieval system