KEGG   Homo sapiens (human): 222662Help
Entry
222662            CDS       T01001                                 

Gene name
LHFPL5, DFNB67, TMHS, dJ510O8.8
Definition
(RefSeq) lipoma HMGIC fusion partner-like 5
Organism
hsa  Homo sapiens (human)
Disease
H00605  
Deafness, autosomal recessive
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.31
AA seq 219 aa AA seqDB search
MVKLLPAQEAAKIYHTNYVRNSRAVGVMWGTLTICFSVLVMALFIQPYWIGDSVNTPQAG
YFGLFSYCVGNVLSSELICKGGPLDFSSIPSRAFKTAMFFVALGMFLIIGSIICFSLFFI
CNTATVYKICAWMQLAAATGLMIGCLVYPDGWDSSEVRRMCGEQTGKYTLGHCTIRWAFM
LAILSIGDALILSFLAFVLGYRQDKLLPDDYKADGTEEV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaattgctgccggcccaggaggcagccaagatctaccataccaactatgtgcgg
aactcgcgagccgtgggcgtgatgtggggtaccctcaccatctgcttctccgtactggtc
atggccctcttcatccagccctactggatcggcgacagcgtcaacacaccgcaggcaggc
tacttcggccttttctcctactgcgtgggtaacgtgctgtcctccgagctcatctgcaag
ggcggccccctagacttctcctccatcccctctagagccttcaagactgccatgttcttt
gtggccttgggcatgttcctcatcattggctccatcatctgcttcagcctgttcttcatc
tgcaacacggccacagtctataagatctgtgcatggatgcagctggctgcggccacaggc
ctaatgattggctgcctggtctaccctgatggttgggactcaagtgaggtgcggcgcatg
tgtggggagcagacgggcaagtacacgctgggccactgcaccatccgctgggccttcatg
ctggccatcctcagcattggcgacgccctcatcctctccttcctggccttcgtgttgggc
taccggcaggacaagctcctccctgacgactacaaggcagatggaaccgaggaggtgtga

DBGET integrated database retrieval system