KEGG   Homo sapiens (human): 223117Help
Entry
223117            CDS       T01001                                 

Gene name
SEMA3D, Sema-Z2, coll-2
Definition
(RefSeq) semaphorin 3D
  KO
K06840  
semaphorin 3
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    223117 (SEMA3D)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     223117 (SEMA3D)
 7. Others
  NRP1; neuropilin 1 [KO:K06724]
   223117 (SEMA3D)
  NRP2; neuropilin 2 [KO:K06819]
   223117 (SEMA3D)
  PLXNA; plexin A [KO:K06820]
   223117 (SEMA3D)
  PLXND; plexin D [KO:K06822]
   223117 (SEMA3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O95025(Tbio)
UniProt: 
Position
7q21.11
AA seq 777 aa AA seqDB search
MNANKDERLKARSQDFHLFPALMMLSMTMLFLPVTGTLKQNIPRLKLTYKDLLLSNSCIP
FLGSSEGLDFQTLLLDEERGRLLLGAKDHIFLLSLVDLNKNFKKIYWPAAKERVELCKLA
GKDANTECANFIRVLQPYNKTHIYVCGTGAFHPICGYIDLGVYKEDIIFKLDTHNLESGR
LKCPFDPQQPFASVMTDEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNG
AKFIGTFFIPDTYNPDDDKIYFFFRESSQEGSTSDKTILSRVGRVCKNDVGGQRSLINKW
TTFLKARLICSIPGSDGADTYFDELQDIYLLPTRDERNPVVYGVFTTTSSIFKGSAVCVY
SMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSKTYDPLIKSTRDFPDDVISF
IKRHSVMYKSVYPVAGGPTFKRINVDYRLTQIVVDHVIAEDGQYDVMFLGTDIGTVLKVV
SISKEKWNMEEVVLEELQIFKHSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTYGKA
CADCCLARDPYCAWDGNACSRYAPTSKRRARRQDVKYGDPITQCWDIEDSISHETADEKV
IFGIEFNSTFLECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
GMYYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEGKVKDLLAESRLRYKDYIQIL
SSPNFSLDQYCEQMWHREKRRQRNKGGPKWKHMQEMKKKRNRRHHRDLDELPRAVAT
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctaataaagatgaaagacttaaagccagaagccaagattttcacctttttcct
gctttgatgatgctaagcatgaccatgttgtttcttccagtcactggcactttgaagcaa
aatattccaagactcaagctaacctacaaagacttgctgctttcaaatagctgtattccc
tttttgggttcatcagaaggactggattttcaaactcttctcttagatgaggaaagaggc
aggctgctcttgggagccaaagaccacatctttctactcagtctggttgacttaaacaaa
aattttaagaagatttattggcctgctgcaaaggaacgggtggaattatgtaaattagct
gggaaagatgccaatacagaatgtgcaaatttcatcagagtacttcagccctataacaaa
actcacatatatgtgtgtggaactggagcatttcatccaatatgtgggtatattgatctt
ggagtctacaaggaggatattatattcaaactagacacacataatttggagtctggcaga
ctgaaatgtcctttcgatcctcagcagccttttgcttcagtaatgacagatgagtacctc
tactctggaacagcttctgatttccttggcaaagatactgcattcactcgatcccttggg
cctactcatgaccaccactacatcagaactgacatttcagagcactactggctcaatgga
gcaaaatttattggaactttcttcataccagacacctacaatccagatgatgataaaata
tatttcttctttcgtgaatcatctcaagaaggcagtacctccgataaaaccatcctttct
cgagttggaagagtttgtaagaatgatgtaggaggacaacgcagcctgataaacaagtgg
acgacttttcttaaggccagactgatttgctcaattcctggaagtgatggggcagatact
tactttgatgagcttcaagatatttatttactccccacaagagatgaaagaaatcctgta
gtatatggagtctttactacaaccagctccatcttcaaaggctctgctgtttgtgtgtat
agcatggctgacatcagagcagtttttaatggtccatatgctcataaggaaagtgcagac
catcgttgggtgcagtatgatgggagaattccttatccacggcctggtacatgtccaagc
aaaacctatgacccactgattaagtccacccgagattttccagatgatgtcatcagtttc
ataaagcggcactctgtgatgtataagtccgtatacccagttgcaggaggaccaacgttc
aagagaatcaatgtggattacagactgacacagatagtggtggatcatgtcattgcagaa
gatggccagtacgatgtaatgtttcttggaacagacattggaactgtcctcaaagttgtc
agcatttcaaaggaaaagtggaatatggaagaggtagtgctggaggagttgcagatattc
aagcactcatcaatcatcttgaacatggaattgtctctgaagcagcaacaattgtacatt
ggttcccgagatggattggttcagctctccttgcacagatgcgacacttatgggaaagct
tgcgcagactgttgtcttgccagagacccctactgtgcctgggatggaaatgcatgctct
cgatatgctcctacttctaaaaggagagctagacgccaagatgtaaaatatggcgaccca
atcacccagtgctgggacatcgaagacagcattagtcatgaaactgctgatgaaaaggtg
atttttggcattgaatttaactcaacctttctggaatgtatacctaaatcccaacaagca
actattaaatggtatatccagaggtcaggggatgagcatcgagaggagttgaagcccgat
gaaagaatcatcaaaacggaatatgggctactgattcgaagtttgcagaagaaggattct
gggatgtattactgcaaagcccaggagcacactttcatccacaccatagtgaagctgact
ttgaatgtcattgagaatgaacagatggaaaatacccagagggcagagcatgaggagggg
aaggtcaaggatctattggctgagtcacggttgagatacaaagactacatccaaatcctt
agcagcccaaacttcagcctcgaccagtactgcgaacagatgtggcacagggagaagcgg
agacagagaaacaaggggggcccaaagtggaagcacatgcaggaaatgaagaagaaacga
aatcgaagacatcacagagacctggatgagctccctagagctgtagccacgtag

DBGET integrated database retrieval system