KEGG   Homo sapiens (human): 2232Help
Entry
2232              CDS       T01001                                 

Gene name
FDXR, ADXR
Definition
(RefSeq) ferredoxin reductase (EC:1.18.1.6)
  KO
K18914  
adrenodoxin-NADP+ reductase [EC:1.18.1.6]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.6  adrenodoxin-NADP+ reductase
     2232 (FDXR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.1
AA seq 491 aa AA seqDB search
MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKH
PQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVP
ELQEAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAV
ILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKE
LREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASAS
RAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSI
GYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQM
LLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLV
DPQEMLRLLGH
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcgctgctggcgctggtggggctggtcggcgtggcctcggacccggctgcct
cccgccgggagcaccccgagcttctgccaccatttctccacacaggagaagaccccccag
atctgtgtggtgggcagtggcccagctggcttctacacggcccaacacctgctaaagcac
ccccaggcccacgtggacatctacgagaaacagcctgtgccctttggcctggtgcgcttt
ggtgtggcgcctgatcaccccgaggtgaagaatgtcatcaacacatttacccagacggcc
cattctggccgctgtgccttctggggcaacgtggaggtgggcagggacgtgacggtgccg
gagctgcaggaggcctaccacgctgtggtgctgagctacggggcagaggaccatcgggcc
ctggaaattcctggtgaggagctgccaggtgtgtgctccgcccgggccttcgtgggctgg
tacaacgggcttcctgagaaccaggagctggagccagacctgagctgtgacacagccgtg
attctggggcaggggaacgtggctctggacgtggcccgcatcctactgaccccacctgag
cacctggagagaacggacatcacgaaggcagccctgggtgtactgaggcagagtcgagtg
aagacagtgtggctagtgggccggcgtggacccctgcaagtggccttcaccattaaggag
cttcgggagatgattcagttaccgggagcccggcccattttggatcctgtggatttcttg
ggtctccaggacaagatcaaggaggtcccccgcccgaggaagcggctgacggaactgctg
cttcgaacggccacagagaagccagggccggcggaagctgcccgccaggcatcggcctcc
cgtgcctggggcctccgctttttccgaagcccccagcaggtgctgccctcaccagatggg
cggcgggcagcaggtgtccgcctagcagtcactagactggagggtgtcgatgaggccacc
cgtgcagtgcccacgggagacatggaagacctcccttgtgggctggtgctcagcagcatt
gggtataagagccgccctgtcgacccaagcgtgccctttgactccaagcttggggtcatc
cccaatgtggagggccgggttatggatgtgccaggcctctactgcagcggctgggtgaag
agaggacctacaggtgtcatagccacaaccatgactgacagcttcctcaccggccagatg
ctgctgcaggacctgaaggctgggttgctcccctctggccccaggcctggctacgcagcc
atccaggccctgctcagcagccgaggggtccggccagtctctttctcagactgggagaag
ctggatgccgaggaggtggcccggggccagggcacggggaagcccagggagaagctggtg
gatcctcaggagatgctgcgcctcctgggccactga

DBGET integrated database retrieval system