KEGG   Homo sapiens (human): 2237Help
Entry
2237              CDS       T01001                                 

Gene name
FEN1, FEN-1, MF1, RAD2
Definition
flap structure-specific endonuclease 1
Orthology
K04799  
flap endonuclease-1 [EC:3.-.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Base excision repair
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    2237 (FEN1)
   03410 Base excision repair
    2237 (FEN1)
   03450 Non-homologous end-joining
    2237 (FEN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     2237 (FEN1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2237 (FEN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q12
AA seq 380 aa AA seqDB search
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAE
QEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSE
PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEP
KGSTKKKAKTGAAGKFKRGK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgggaattcaaggcctggccaaactaattgctgatgtggcccccagtgccatccgggag
aatgacatcaagagctactttggccgtaaggtggccattgatgcctctatgagcatttat
cagttcctgattgctgttcgccagggtggggatgtgctgcagaatgaggagggtgagacc
accagccacctgatgggcatgttctaccgcaccattcgcatgatggagaacggcatcaag
cccgtgtatgtctttgatggcaagccgccacagctcaagtcaggcgagctggccaaacgc
agtgagcggcgggctgaggcagagaagcagctgcagcaggctcaggctgctggggccgag
caggaggtggaaaaattcactaagcggctggtgaaggtcactaagcagcacaatgatgag
tgcaaacatctgctgagcctcatgggcatcccttatcttgatgcacccagtgaggcagag
gccagctgtgctgccctggtgaaggctggcaaagtctatgctgcggctaccgaggacatg
gactgcctcaccttcggcagccctgtgctaatgcgacacctgactgccagtgaagccaaa
aagctgccaatccaggaattccacctgagccggattctgcaggagctgggcctgaaccag
gaacagtttgtggatctgtgcatcctgctaggcagtgactactgtgagagtatccggggt
attgggcccaagcgggctgtggacctcatccagaagcacaagagcatcgaggagatcgtg
cggcgacttgaccccaacaagtaccctgtgccagaaaattggctccacaaggaggctcac
cagctcttcttggaacctgaggtgctggacccagagtctgtggagctgaagtggagcgag
ccaaatgaagaagagctgatcaagttcatgtgtggtgaaaagcagttctctgaggagcga
atccgcagtggggtcaagaggctgagtaagagccgccaaggcagcacccagggccgcctg
gatgatttcttcaaggtgaccggctcactctcttcagctaagcgcaaggagccagaaccc
aagggatccactaagaagaaggcaaagactggggcagcagggaagtttaaaaggggaaaa
taa

DBGET integrated database retrieval system