KEGG   Homo sapiens (human): 2241Help
Entry
2241              CDS       T01001                                 

Gene name
FER, PPP1R74, TYK3, p94-Fer
Definition
(RefSeq) FER tyrosine kinase
  KO
K08889  
tyrosine-protein kinase Fer [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    2241 (FER)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     2241 (FER)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Fer family
   2241 (FER)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     2241 (FER)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    2241 (FER)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P16591(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
5q21.3
AA seq 822 aa AA seqDB search
MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTVQ
MNYVSNVSKSWLLMIQQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQ
IEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHM
LHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEI
VNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNL
TAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQAL
EELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSK
FESIRHSIAGIIRSPKSALGSSALSDMISISEKPLAEQDWYHGAIPRIEAQELLKKQGDF
LVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITK
KSGVVLLNPIPKDKKWILSHEDVILGELLGKGNFGEVYKGTLKDKTSVAVKTCKEDLPQE
LKIKFLQEAKILKQYDHPNIVKLIGVCTQRQPVYIIMELVSGGDFLTFLRRKKDELKLKQ
LVKFSLDAAAGMLYLESKNCIHRDLAARNCLVGENNVLKISDFGMSRQEDGGVYSSSGLK
QIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRMS
APQHCPEDISKIMMKCWDYKPENRPKFSELQKELTIIKRKLT
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggggtttgggagtgacctgaagaattcacatgaagcagtgttaaaattgcaagactgg
gaattacggttactggaaacagtaaagaaatttatggccctgagaataaaaagtgataaa
gaatatgcatctactttacagaacctttgtaatcaagttgataaggaaagtactgtccaa
atgaattatgtcagcaacgtatccaagtcttggctacttatgattcagcagacagaacaa
cttagtaggataatgaagacacatgcagaggacttgaactctggacctttacacaggctc
accatgatgattaaggacaagcagcaggtgaagaaaagttacataggtgttcatcagcag
atagaggcagagatgatcaaggttaccaaaacagaattggagaagttaaaatgcagctat
agacaattaataaaagaaatgaattctgccaaagagaaatataaagaagctttagctaaa
gggaaggaaactgaaaaggccaaggaacgatacgacaaagccacaatgaaacttcatatg
ttgcacaatcagtatgtattggcgttgaaaggggcacagctccatcagaatcagtattat
gatatcacacttcccctgcttctggactccttacaaaagatgcaagaagaaatgataaaa
gcactcaaaggtatatttgatgaatacagccagataaccagtcttgtcacagaggaaata
gtgaatgtccataaagagattcaaatgtcggttgaacagatagatcctagtacagaatac
aataatttcatagatgttcacagaacaacggctgctaaagaacaagaaatagagtttgat
acttccttactggaagaaaatgaaaatcttcaggcaaatgagatcatgtggaataactta
acagcagaaagtttgcaagtaatgttgaaaacgttagcggaagaacttatgcaaacacag
cagatgcttttaaacaaggaggaggctgttttggagttagagaagagaattgaagaatct
tctgaaacttgtgagaagaagtctgatattgtgcttctgctaagccaaaaacaggcactt
gaagaactgaaacagtcagtccagcagctgagatgcactgaagcaaagttttcagcacag
aaggaattactagagcaaaaagtgcaagaaaatgatgggaaagagccacctccagtagta
aattatgaagaagatgcacgatcagttacatctatggaaagaaaggagaggctatccaaa
tttgaatctattcgtcattcaattgctggaataattaggtctccaaaatctgcactgggc
tcttcagcactttctgatatgatctccatcagtgagaagcctttggcagaacaggactgg
taccatggtgcaattcccagaatagaagctcaagaactgttaaaaaaacaaggagacttt
ttggtgcgagagagtcatgggaaacctggtgaatatgtcctttctgtatattctgatgga
cagaggagacattttatcatacaatatgttgataacatgtatcgattcgagggcactggg
ttttcaaacattcctcaacttatagatcatcactatacaacaaaacaggtcatcactaag
aaatcaggtgtagttctgctgaatcctattcctaaggacaagaaatggattctcagtcat
gaagatgtcatattgggagaattactgggcaagggaaattttggtgaagtatataagggc
acattaaaggataaaacttctgttgctgttaaaacatgtaaagaagatcttcctcaggaa
ttgaaaataaaatttttacaagaagccaaaattctcaagcaatatgatcatcccaatatt
gtcaaacttataggagtttgcacacaaagacagcctgtctacatcattatggaactggtt
tcaggaggtgatttcctcacctttctgagaaggaagaaggatgaactaaaactcaaacag
ttagtgaaattttcattagacgctgctgctggtatgttgtatctcgagagtaaaaactgt
atacacagggaccttgctgcaagaaactgcctggtaggtgaaaataatgttctgaaaatc
agtgactttggaatgtctcgtcaagaggatggtggagtgtattcatcttctggcttaaag
cagattcccattaaatggacagcaccggaagctcttaattatgggagatacagttcagag
agtgacgtgtggagctttggcatccttctctgggagaccttcagcttaggggtttgtccg
taccctggaatgacaaatcagcaagcaagagagcaagtagaaagaggataccggatgtca
gctccccagcactgtccagaggatatttccaaaatcatgatgaagtgttgggattataaa
cctgaaaatcgccctaagttcagtgaacttcagaaagagctcactatcatcaagagaaaa
ctcacatag

DBGET integrated database retrieval system