KEGG   Homo sapiens (human): 2242Help
Entry
2242              CDS       T01001                                 

Gene name
FES, FPS
Definition
(RefSeq) FES proto-oncogene, tyrosine kinase (EC:2.7.10.2)
  KO
K07527  
tyrosine-protein kinase Fes/Fps [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    2242 (FES)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     2242 (FES)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Fer family
   2242 (FES)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q26.1
AA seq 822 aa AA seqDB search
MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQS
RAISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQW
QQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLF
AHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDE
VVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEPGELQLNE
LTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRERVQLLGKRQVL
QEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHSTSSSEQEREGGR
TPTLEILKSHISGIFRPKFSLPPPLQLIPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDF
LVRESQGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKK
SGVVLHRAVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDL
KAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKTL
LQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGVYAASGGLR
QVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVEKGGRLP
CPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgggcttctcttccgagctgtgcagcccccagggccacggggtcctgcagcaaatgcag
gaggccgagcttcgtctactggagggcatgagaaagtggatggcccagcgggtcaagagt
gacagggagtatgcaggactgcttcaccacatgtccctgcaggacagtgggggccagagc
cgggccatcagccctgacagccccatcagtcagtcctgggctgagatcaccagccaaact
gagggcctgagccgcttgctgcggcagcacgcagaggatctgaactcagggcccctgagc
aagctgagcctgctcatccgggaacggcagcagcttcgcaagacctacagcgagcagtgg
cagcagctgcagcaggagctcaccaagacccacagccaggacattgagaagctgaagagc
cagtaccgagctctggcacgggacagtgcccaagccaagcgcaagtaccaggaggccagc
aaagacaaggaccgtgacaaggctaaggacaagtatgtgcgcagcctgtggaagctcttt
gctcaccacaaccgctatgtgctgggcgtgcgggctgcgcagctacaccaccagcaccac
caccagctcctgctgcccggcctgctgcggtcactgcaggacctgcacgaggagatggct
tgcatcctgaaggagatcctgcaggaatacctggagattagcagcctggtgcaggatgag
gtggtggccattcaccgggagatggctgcagctgctgcccgcatccagcctgaggctgag
taccaaggcttcctgcgacagtatgggtccgcacctgacgtcccaccctgtgtcacgttc
gatgagtcactgcttgaggagggtgaaccgctggagcctggggagctccagctgaacgag
ctgactgtggagagcgtgcagcacacgctgacctcagtgacagatgagctggctgtggcc
accgagatggtgttcaggcggcaggagatggttacgcagctgcaacaggagctccggaat
gaagaggagaacacccacccccgggagcgggtgcagctgctgggcaagaggcaagtgctg
caagaagcactgcaggggctgcaggtagcgctgtgcagccaggccaagctgcaggcccag
caggagttgctgcagaccaagctggagcacctgggccccggcgagcccccgcctgtgctg
ctcctgcaggatgaccgccactccacgtcgtcctcggagcaggagcgagaggggggaagg
acacccacgctggagatccttaagagccacatctcaggaatcttccgccccaagttctcg
ctccctccaccgctgcagctcattccggaggtgcagaagcccctgcatgagcagctgtgg
taccacggggccatcccgagggcagaggtggctgagctgctggtgcactctggggacttc
ctggtgcgggagagccagggcaagcaggagtacgtgctgtcggtgctgtgggatggtctg
ccccggcacttcatcatccagtccttggataacctgtaccgactggaaggggaaggcttt
cctagcattcctttgctcatcgaccacctactgagcacccagcagcccctcaccaagaag
agtggtgttgtcctgcacagggctgtgcccaaggacaagtgggtgctgaaccatgaggac
ctggtgttgggtgagcagattggacgggggaactttggcgaagtgttcagcggacgcctg
cgagccgacaacaccctggtggcggtgaagtcttgtcgagagacgctcccacctgacctc
aaggccaagtttctacaggaagcgaggatcctgaagcagtacagccaccccaacatcgtg
cgtctcattggtgtctgcacccagaagcagcccatctacatcgtcatggagcttgtgcag
gggggcgacttcctgaccttcctccgcacggagggggcccgcctgcgggtgaagactctg
ctgcagatggtgggggatgcagctgctggcatggagtacctggagagcaagtgctgcatc
caccgggacctggctgctcggaactgcctggtgacagagaagaatgtcctgaagatcagt
gactttgggatgtcccgagaggaagccgatggggtctatgcagcctcagggggcctcaga
caagtccccgtgaagtggaccgcacctgaggcccttaactacggccgctactcctccgaa
agcgacgtgtggagctttggcatcttgctctgggagaccttcagcctgggggcctccccc
tatcccaacctcagcaatcagcagacacgggagtttgtggagaaggggggccgtctgccc
tgcccagagctgtgtcctgatgccgtgttcaggctcatggagcagtgctgggcctatgag
cctgggcagcggcccagcttcagcaccatctaccaggagctgcagagcatccgaaagcgg
catcggtga

DBGET integrated database retrieval system