KEGG   Homo sapiens (human): 2244Help
Entry
2244              CDS       T01001                                 

Gene name
FGB, HEL-S-78p
Definition
(RefSeq) fibrinogen beta chain
  KO
K03904  
fibrinogen beta chain
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Platelet activation
Disease
H00222  
Afibrinogenemia
H00223  
Inherited thrombophilia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    2244 (FGB)
   04611 Platelet activation
    2244 (FGB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   2244 (FGB)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta2 integrins
   CR3, Mac-1
    ITGB2; integrin beta 2 [KO:K06464]
     2244 (FGB)
   p150/95
     2244 (FGB)
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     2244 (FGB)
   VNR
     2244 (FGB)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   2244 (FGB)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   2244 (FGB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q28
AA seq 491 aa AA seqDB search
MKRMVSWSFHKLKTMKHLLLLLLCVFLVKSQGVNDNEEGFFSARGHRPLDKKREEAPSLR
PAPPPISGGGYRARPAKAAATQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQE
RPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQ
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKE
CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYK
QGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFT
VQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDP
RKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKM
SMKIRPFFPQQ
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggatggtttcttggagcttccacaaacttaaaaccatgaaacatctattattg
ctactattgtgtgtttttctagttaagtcccaaggtgtcaacgacaatgaggagggtttc
ttcagtgcccgtggtcatcgaccccttgacaagaagagagaagaggctcccagcctgagg
cctgccccaccgcccatcagtggaggtggctatcgggctcgtccagccaaagcagctgcc
actcaaaagaaagtagaaagaaaagcccctgatgctggaggctgtcttcacgctgaccca
gacctgggggtgttgtgtcctacaggatgtcagttgcaagaggctttgctacaacaggaa
aggccaatcagaaatagtgttgatgagttaaataacaatgtggaagctgtttcccagacc
tcctcttcttcctttcagtacatgtatttgctgaaagacctgtggcaaaagaggcagaag
caagtaaaagataatgaaaatgtagtcaatgagtactcctcagaactggaaaagcaccaa
ttatatatagatgagactgtgaatagcaatatcccaactaaccttcgtgtgcttcgttca
atcctggaaaacctgagaagcaaaatacaaaagttagaatctgatgtctcagctcaaatg
gaatattgtcgcaccccatgcactgtcagttgcaatattcctgtggtgtctggcaaagaa
tgtgaggaaattatcaggaaaggaggtgaaacatctgaaatgtatctcattcaacctgac
agttctgtcaaaccgtatagagtatactgtgacatgaatacagaaaatggaggatggaca
gtgattcagaaccgtcaagacggtagtgttgactttggcaggaaatgggatccatataaa
cagggatttggaaatgttgcaaccaacacagatgggaagaattactgtggcctaccaggt
gaatattggcttggaaatgataaaattagccagcttaccaggatgggacccacagaactt
ttgatagaaatggaggactggaaaggagacaaagtaaaggctcactatggaggattcact
gtacagaatgaagccaacaaataccagatctcagtgaacaaatacagaggaacagccggt
aatgccctcatggatggagcatctcagctgatgggagaaaacaggaccatgaccattcac
aacggcatgttcttcagcacgtatgacagagacaatgacggctggttaacatcagatccc
agaaaacagtgttctaaagaagacggtggtggatggtggtataatagatgtcatgcagcc
aatccaaacggcagatactactggggtggacagtacacctgggacatggcaaagcatggc
acagatgatggtgtagtatggatgaattggaaggggtcatggtactcaatgaggaagatg
agtatgaagatcaggcccttcttcccacagcaatag

DBGET integrated database retrieval system