KEGG   Homo sapiens (human): 2246Help
Entry
2246              CDS       T01001                                 

Gene name
FGF1, AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-1, FGF-alpha, FGFA, GLIO703, HBGF-1, HBGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  
fibroblast growth factor 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Hippo signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2246 (FGF1)
   04015 Rap1 signaling pathway
    2246 (FGF1)
   04010 MAPK signaling pathway
    2246 (FGF1)
   04390 Hippo signaling pathway
    2246 (FGF1)
   04151 PI3K-Akt signaling pathway
    2246 (FGF1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2246 (FGF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2246 (FGF1)
   05218 Melanoma
    2246 (FGF1)
   05224 Breast cancer
    2246 (FGF1)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2246 (FGF1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2246 (FGF1)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2246 (FGF1)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2246 (FGF1)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2246 (FGF1)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2246 (FGF1)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2246 (FGF1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2246 (FGF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P05230(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.3
AA seq 155 aa AA seqDB search
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaggggaaatcaccaccttcacagccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggagaaccattacaacacctatatatccaagaagcatgcagagaag
aattggtttgttggcctcaagaagaatgggagctgcaaacgcggtcctcggactcactat
ggccagaaagcaatcttgtttctccccctgccagtctcttctgattaa

KEGG   Homo sapiens (human): 2247Help
Entry
2247              CDS       T01001                                 

Gene name
FGF2, BFGF, FGF-2, FGFB, HBGF-2
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18497  
fibroblast growth factor 2
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2247 (FGF2)
   04015 Rap1 signaling pathway
    2247 (FGF2)
   04010 MAPK signaling pathway
    2247 (FGF2)
   04151 PI3K-Akt signaling pathway
    2247 (FGF2)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    2247 (FGF2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    2247 (FGF2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2247 (FGF2)
   05205 Proteoglycans in cancer
    2247 (FGF2)
   05218 Melanoma
    2247 (FGF2)
   05224 Breast cancer
    2247 (FGF2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    2247 (FGF2)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2247 (FGF2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2247 (FGF2)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2247 (FGF2)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2247 (FGF2)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2247 (FGF2)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2247 (FGF2)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2247 (FGF2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2247 (FGF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P09038(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
4q28.1
AA seq 288 aa AA seqDB search
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ctggtgggtgtggggggtggagatgtagaagatgtgacgccgcggcccggcgggtgccag
attagcggacgcggtgcccgcggttgcaacgggatcccgggcgctgcagcttgggaggcg
gctctccccaggcggcgtccgcggagacacccatccgtgaaccccaggtcccgggccgcc
ggctcgccgcgcaccaggggccggcggacagaagagcggccgagcggctcgaggctgggg
gaccgcgggcgcggccgcgcgctgccgggcgggaggctggggggccggggccggggccgt
gccccggagcgggtcggaggccggggccggggccgggggacggcggctccccgcgcggct
ccagcggctcggggatcccggccgggccccgcagggaccatggcagccgggagcatcacc
acgctgcccgccttgcccgaggatggcggcagcggcgccttcccgcccggccacttcaag
gaccccaagcggctgtactgcaaaaacgggggcttcttcctgcgcatccaccccgacggc
cgagttgacggggtccgggagaagagcgaccctcacatcaagctacaacttcaagcagaa
gagagaggagttgtgtctatcaaaggagtgtgtgctaaccgttacctggctatgaaggaa
gatggaagattactggcttctaaatgtgttacggatgagtgtttcttttttgaacgattg
gaatctaataactacaatacttaccggtcaaggaaatacaccagttggtatgtggcactg
aaacgaactgggcagtataaacttggatccaaaacaggacctgggcagaaagctatactt
tttcttccaatgtctgctaagagctga

KEGG   Homo sapiens (human): 2248Help
Entry
2248              CDS       T01001                                 

Gene name
FGF3, HBGF-3, INT2
Definition
(RefSeq) fibroblast growth factor 3
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Disease
H00041  
Kaposi's sarcoma
H00605  
Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2248 (FGF3)
   04015 Rap1 signaling pathway
    2248 (FGF3)
   04010 MAPK signaling pathway
    2248 (FGF3)
   04151 PI3K-Akt signaling pathway
    2248 (FGF3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2248 (FGF3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2248 (FGF3)
   05218 Melanoma
    2248 (FGF3)
   05224 Breast cancer
    2248 (FGF3)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2248 (FGF3)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2248 (FGF3)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2248 (FGF3)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2248 (FGF3)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2248 (FGF3)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2248 (FGF3)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2248 (FGF3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2248 (FGF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P11487(Tbio)
UniProt: 
Position
11q13.3
AA seq 239 aa AA seqDB search
MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVER
IHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggcctaatctggctgctactgctcagcctgctggagcccggctggcccgcagcgggc
cctggggcgcggttgcggcgcgatgcgggcggccgtggcggcgtctacgagcaccttggc
ggggcgccccggcgccgcaagctctactgcgccacgaagtaccacctccagctgcacccg
agcggccgcgtcaacggcagcctggagaacagcgcctacagtattttggagataacggca
gtggaggtgggcattgtggccatcaggggtctcttctccgggcggtacctggccatgaac
aagaggggacgactctatgcttcggagcactacagcgccgagtgcgagtttgtggagcgg
atccacgagctgggctataatacgtatgcctcccggctgtaccggacggtgtctagtacg
cctggggcccgccggcagcccagcgccgagagactgtggtacgtgtctgtgaacggcaag
ggccggccccgcaggggcttcaagacccgccgcacacagaagtcctccctgttcctgccc
cgcgtgctggaccacagggaccacgagatggtgcggcagctacagagtgggctgcccaga
ccccctggtaagggggtccagccccgacggcggcggcagaagcagagcccggataacctg
gagccctctcacgttcaggcttcgagactgggctcccagctggaggccagtgcgcactag

KEGG   Homo sapiens (human): 2249Help
Entry
2249              CDS       T01001                                 

Gene name
FGF4, HBGF-4, HST, HST-1, HSTF1, K-FGF, KFGF
Definition
(RefSeq) fibroblast growth factor 4
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2249 (FGF4)
   04015 Rap1 signaling pathway
    2249 (FGF4)
   04010 MAPK signaling pathway
    2249 (FGF4)
   04151 PI3K-Akt signaling pathway
    2249 (FGF4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2249 (FGF4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2249 (FGF4)
   05218 Melanoma
    2249 (FGF4)
   05224 Breast cancer
    2249 (FGF4)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2249 (FGF4)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2249 (FGF4)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2249 (FGF4)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2249 (FGF4)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2249 (FGF4)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2249 (FGF4)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2249 (FGF4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2249 (FGF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P08620(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.3
AA seq 206 aa AA seqDB search
MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPV
AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP
VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIA
LSKNGKTKKGNRVSPTMKVTHFLPRL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggcccgggacggccgcggtagcgctgctcccggcggtcctgctggccttgctg
gcgccctgggcgggccgagggggcgccgccgcacccactgcacccaacggcacgctggag
gccgagctggagcgccgctgggagagcctggtggcgctctcgttggcgcgcctgccggtg
gcagcgcagcccaaggaggcggccgtccagagcggcgccggcgactacctgctgggcatc
aagcggctgcggcggctctactgcaacgtgggcatcggcttccacctccaggcgctcccc
gacggccgcatcggcggcgcgcacgcggacacccgcgacagcctgctggagctctcgccc
gtggagcggggcgtggtgagcatcttcggcgtggccagccggttcttcgtggccatgagc
agcaagggcaagctctatggctcgcccttcttcaccgatgagtgcacgttcaaggagatt
ctccttcccaacaactacaacgcctacgagtcctacaagtaccccggcatgttcatcgcc
ctgagcaagaatgggaagaccaagaaggggaaccgagtgtcgcccaccatgaaggtcacc
cacttcctccccaggctgtga

KEGG   Homo sapiens (human): 2250Help
Entry
2250              CDS       T01001                                 

Gene name
FGF5, HBGF-5, Smag-82, TCMGLY
Definition
(RefSeq) fibroblast growth factor 5
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2250 (FGF5)
   04015 Rap1 signaling pathway
    2250 (FGF5)
   04010 MAPK signaling pathway
    2250 (FGF5)
   04151 PI3K-Akt signaling pathway
    2250 (FGF5)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2250 (FGF5)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2250 (FGF5)
   05218 Melanoma
    2250 (FGF5)
   05224 Breast cancer
    2250 (FGF5)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2250 (FGF5)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2250 (FGF5)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2250 (FGF5)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2250 (FGF5)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2250 (FGF5)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2250 (FGF5)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2250 (FGF5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2250 (FGF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P12034(Tbio)
UniProt: 
Position
4q21.21
AA seq 268 aa AA seqDB search
MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSAS
SSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSV
LEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHR
TEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPP
SPIKPKIPLSAPRKNTNSVKYRLKFRFG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgtccttcctcctcctcctcttcttcagccacctgatcctcagcgcctgggct
cacggggagaagcgtctcgcccccaaagggcaacccggacccgctgccactgataggaac
cctagaggctccagcagcagacagagcagcagtagcgctatgtcttcctcttctgcctcc
tcctcccccgcagcttctctgggcagccaaggaagtggcttggagcagagcagtttccag
tggagcccctcggggcgccggaccggcagcctctactgcagagtgggcatcggtttccat
ctgcagatctacccggatggcaaagtcaatggatcccacgaagccaatatgttaagtgtt
ttggaaatatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaacaaa
tttttagcgatgtcaaaaaaaggaaaactccatgcaagtgccaagttcacagatgactgc
aagttcagggagcgttttcaagaaaatagctataatacctatgcctcagcaatacataga
actgaaaaaacagggcgggagtggtatgtggccctgaataaaagaggaaaagccaaacga
gggtgcagcccccgggttaaaccccagcatatctctacccattttctgccaagattcaag
cagtcggagcagccagaactttctttcacggttactgttcctgaaaagaaaaagccacct
agccctatcaagccaaagattcccctttctgcacctcggaaaaataccaactcagtgaaa
tacagactcaagtttcgctttggataa

KEGG   Homo sapiens (human): 2251Help
Entry
2251              CDS       T01001                                 

Gene name
FGF6, HBGF-6, HST2
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2251 (FGF6)
   04015 Rap1 signaling pathway
    2251 (FGF6)
   04010 MAPK signaling pathway
    2251 (FGF6)
   04151 PI3K-Akt signaling pathway
    2251 (FGF6)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2251 (FGF6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2251 (FGF6)
   05218 Melanoma
    2251 (FGF6)
   05224 Breast cancer
    2251 (FGF6)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2251 (FGF6)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2251 (FGF6)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2251 (FGF6)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2251 (FGF6)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2251 (FGF6)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2251 (FGF6)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2251 (FGF6)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2251 (FGF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P10767(Tbio)
UniProt: 
Position
12p13.32
AA seq 208 aa AA seqDB search
MALGQKLFITMSRGAGRLQGTLWALVFLGILVGMVVPSPAGTRANNTLLDSRGWGTLLSR
SRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGRISGTHEENPYSLLEI
STVERGVVSLFGVRSALFVAMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYQGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccctgggacagaaactgttcatcactatgtcccggggagcaggacgtctgcagggc
acgctgtgggctctcgtcttcctaggcatcctagtgggcatggtggtgccctcgcctgca
ggcacccgtgccaacaacacgctgctggactcgaggggctggggcaccctgctgtccagg
tctcgcgccgggctagctggagagattgccggggtgaactgggaaagtggctatttggtg
gggatcaagcggcagcggaggctctactgcaacgtgggcatcggctttcacctccaggtg
ctccccgacggccggatcagcgggacccacgaggagaacccctacagcctgctggaaatt
tccactgtggagcgaggcgtggtgagtctctttggagtgagaagtgccctcttcgttgcc
atgaacagtaaaggaagattgtacgcaacgcccagcttccaagaagaatgcaagttcaga
gaaaccctcctgcccaacaattacaatgcctacgagtcagacttgtaccaagggacctac
attgccctgagcaaatacggacgggtaaagcggggcagcaaggtgtccccgatcatgact
gtcactcatttccttcccaggatctaa

KEGG   Homo sapiens (human): 2252Help
Entry
2252              CDS       T01001                                 

Gene name
FGF7, HBGF-7, KGF
Definition
(RefSeq) fibroblast growth factor 7
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2252 (FGF7)
   04015 Rap1 signaling pathway
    2252 (FGF7)
   04010 MAPK signaling pathway
    2252 (FGF7)
   04151 PI3K-Akt signaling pathway
    2252 (FGF7)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2252 (FGF7)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2252 (FGF7)
   05218 Melanoma
    2252 (FGF7)
   05224 Breast cancer
    2252 (FGF7)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2252 (FGF7)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2252 (FGF7)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2252 (FGF7)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2252 (FGF7)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2252 (FGF7)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2252 (FGF7)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2252 (FGF7)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2252 (FGF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P21781(Tbio)
UniProt: 
Position
15q21.2
AA seq 194 aa AA seqDB search
MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaatggatactgacatggatcctgccaactttgctctacagatcatgctttcac
attatctgtctagtgggtactatatctttagcttgcaatgacatgactccagagcaaatg
gctacaaatgtgaactgttccagccctgagcgacacacaagaagttatgattacatggaa
ggaggggatataagagtgagaagactcttctgtcgaacacagtggtacctgaggatcgat
aaaagaggcaaagtaaaagggacccaagagatgaagaataattacaatatcatggaaatc
aggacagtggcagttggaattgtggcaatcaaaggggtggaaagtgaattctatcttgca
atgaacaaggaaggaaaactctatgcaaagaaagaatgcaatgaagattgtaacttcaaa
gaactaattctggaaaaccattacaacacatatgcatcagctaaatggacacacaacgga
ggggaaatgtttgttgccttaaatcaaaaggggattcctgtaagaggaaaaaaaacgaag
aaagaacaaaaaacagcccactttcttcctatggcaataacttaa

KEGG   Homo sapiens (human): 2253Help
Entry
2253              CDS       T01001                                 

Gene name
FGF8, AIGF, FGF-8, HBGF-8, HH6, KAL6
Definition
(RefSeq) fibroblast growth factor 8
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Disease
H00255  
Hypogonadotropic hypogonadism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2253 (FGF8)
   04015 Rap1 signaling pathway
    2253 (FGF8)
   04010 MAPK signaling pathway
    2253 (FGF8)
   04151 PI3K-Akt signaling pathway
    2253 (FGF8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2253 (FGF8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2253 (FGF8)
   05218 Melanoma
    2253 (FGF8)
   05224 Breast cancer
    2253 (FGF8)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2253 (FGF8)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2253 (FGF8)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2253 (FGF8)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2253 (FGF8)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2253 (FGF8)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2253 (FGF8)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2253 (FGF8)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2253 (FGF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P55075(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
10q24.32
AA seq 233 aa AA seqDB search
MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLV
TDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGA
ETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKG
SKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcccccgctccgcgctgagctgcctgctgttgcacttgctggtcctctgcctc
caagcccaggaaggcccgggcaggggccctgcgctgggcagggagctcgcttccctgttc
cgggctggccgggagccccagggtgtctcccaacagcatgtgagggagcagagcctggtg
acggatcagctcagccgccgcctcatccggacctaccaactctacagccgcaccagcggg
aagcacgtgcaggtcctggccaacaagcgcatcaacgccatggcagaggacggcgacccc
ttcgcaaagctcatcgtggagacggacacctttggaagcagagttcgagtccgaggagcc
gagacgggcctctacatctgcatgaacaagaaggggaagctgatcgccaagagcaacggc
aaaggcaaggactgcgtcttcacggagattgtgctggagaacaactacacagcgctgcag
aatgccaagtacgagggctggtacatggccttcacccgcaagggccggccccgcaagggc
tccaagacgcggcagcaccagcgtgaggtccacttcatgaagcggctgccccggggccac
cacaccaccgagcagagcctgcgcttcgagttcctcaactacccgcccttcacgcgcagc
ctgcgcggcagccagaggacttgggcccccgagccccgatag

KEGG   Homo sapiens (human): 2254Help
Entry
2254              CDS       T01001                                 

Gene name
FGF9, FGF-9, GAF, HBFG-9, HBGF-9, SYNS3
Definition
(RefSeq) fibroblast growth factor 9
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Disease
H00484  
Other brachydactylies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2254 (FGF9)
   04015 Rap1 signaling pathway
    2254 (FGF9)
   04010 MAPK signaling pathway
    2254 (FGF9)
   04151 PI3K-Akt signaling pathway
    2254 (FGF9)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2254 (FGF9)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2254 (FGF9)
   05218 Melanoma
    2254 (FGF9)
   05224 Breast cancer
    2254 (FGF9)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2254 (FGF9)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2254 (FGF9)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2254 (FGF9)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2254 (FGF9)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2254 (FGF9)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2254 (FGF9)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2254 (FGF9)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2254 (FGF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P31371(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
13q12.11
AA seq 208 aa AA seqDB search
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcggtaccgtttggg
aatgtgcccgtgttgccggtggacagcccggttttgttaagtgaccacctgggtcagtcc
gaagcaggggggctccccaggggacccgcagtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctatactgcaggactggatttcacttagaaatcttccccaatggt
actatccagggaaccaggaaagaccacagccgatttggcattctggaatttatcagtata
gcagtgggcctggtcagcattcgaggcgtggacagtggactctacctcgggatgaatgag
aagggggagctgtatggatcagaaaaactaacccaagagtgtgtattcagagaacagttc
gaagaaaactggtataatacgtactcatcaaacctatataagcacgtggacactggaagg
cgatactatgttgcattaaataaagatgggaccccgagagaagggactaggactaaacgg
caccagaaattcacacattttttacctagaccagtggaccccgacaaagtacctgaactg
tataaggatattctaagccaaagttga

KEGG   Homo sapiens (human): 2255Help
Entry
2255              CDS       T01001                                 

Gene name
FGF10
Definition
(RefSeq) fibroblast growth factor 10
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Disease
H00642  
Lacrimo-auriculo-dento-digital syndrome (LADD)
H00677  
Aplasia of lacrimal and salivary glands
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2255 (FGF10)
   04015 Rap1 signaling pathway
    2255 (FGF10)
   04010 MAPK signaling pathway
    2255 (FGF10)
   04151 PI3K-Akt signaling pathway
    2255 (FGF10)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2255 (FGF10)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2255 (FGF10)
   05218 Melanoma
    2255 (FGF10)
   05224 Breast cancer
    2255 (FGF10)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2255 (FGF10)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2255 (FGF10)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2255 (FGF10)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2255 (FGF10)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2255 (FGF10)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2255 (FGF10)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2255 (FGF10)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2255 (FGF10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O15520(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
5p12
AA seq 208 aa AA seqDB search
MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSP
SSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGV
VAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVAL
NGKGAPRRGQKTRRKNTSAHFLPMVVHS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaatggatactgacacattgtgcctcagcctttccccacctgcccggctgctgc
tgctgctgctttttgttgctgttcttggtgtcttccgtccctgtcacctgccaagccctt
ggtcaggacatggtgtcaccagaggccaccaactcttcttcctcctccttctcctctcct
tccagcgcgggaaggcatgtgcggagctacaatcaccttcaaggagatgtccgctggaga
aagctattctctttcaccaagtactttctcaagattgagaagaacgggaaggtcagcggg
accaagaaggagaactgcccgtacagcatcctggagataacatcagtagaaatcggagtt
gttgccgtcaaagccattaacagcaactattacttagccatgaacaagaaggggaaactc
tatggctcaaaagaatttaacaatgactgtaagctgaaggagaggatagaggaaaatgga
tacaatacctatgcatcatttaactggcagcataatgggaggcaaatgtatgtggcattg
aatggaaaaggagctccaaggagaggacagaaaacacgaaggaaaaacacctctgctcac
tttcttccaatggtggtacactcatag

KEGG   Homo sapiens (human): 2256Help
Entry
2256              CDS       T01001                                 

Gene name
FGF11, FGF-11, FHF-3, FHF3
Definition
(RefSeq) fibroblast growth factor 11
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2256 (FGF11)
   04015 Rap1 signaling pathway
    2256 (FGF11)
   04010 MAPK signaling pathway
    2256 (FGF11)
   04151 PI3K-Akt signaling pathway
    2256 (FGF11)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2256 (FGF11)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2256 (FGF11)
   05218 Melanoma
    2256 (FGF11)
   05224 Breast cancer
    2256 (FGF11)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2256 (FGF11)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2256 (FGF11)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2256 (FGF11)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2256 (FGF11)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2256 (FGF11)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2256 (FGF11)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2256 (FGF11)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2256 (FGF11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q92914(Tdark)
UniProt: 
Position
17p13.1
AA seq 225 aa AA seqDB search
MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARP
DRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAK
LGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQ
VMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctggccagtagcctgatccggcagaagcgggaggtccgcgagcccgggggc
agccggccggtgtcggcgcagcggcgcgtgtgtccccgcggcaccaagtccctttgccag
aagcagctcctcatcctgctgtccaaggtgcgactgtgcggggggcggcccgcgcggccg
gaccgcggcccggagcctcagctcaaaggcatcgtcaccaaactgttctgccgccagggt
ttctacctccaggcgaatcccgacggaagcatccagggcaccccagaggataccagctcc
ttcacccacttcaacctgatccctgtgggcctccgtgtggtcaccatccagagcgccaag
ctgggtcactacatggccatgaatgctgagggactgctctacagttcgccgcatttcaca
gctgagtgtcgctttaaggagtgtgtctttgagaattactacgtcctgtacgcctctgct
ctctaccgccagcgtcgttctggccgggcctggtacctcggcctggacaaggagggccag
gtcatgaagggaaaccgagttaagaagaccaaggcagctgcccactttctgcccaagctc
ctggaggtggccatgtaccaggagccttctctccacagtgtccccgaggcctccccttcc
agtccccctgccccctga

KEGG   Homo sapiens (human): 2257Help
Entry
2257              CDS       T01001                                 

Gene name
FGF12, EIEE47, FGF12B, FHF1
Definition
(RefSeq) fibroblast growth factor 12
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2257 (FGF12)
   04015 Rap1 signaling pathway
    2257 (FGF12)
   04010 MAPK signaling pathway
    2257 (FGF12)
   04151 PI3K-Akt signaling pathway
    2257 (FGF12)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2257 (FGF12)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2257 (FGF12)
   05218 Melanoma
    2257 (FGF12)
   05224 Breast cancer
    2257 (FGF12)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2257 (FGF12)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2257 (FGF12)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2257 (FGF12)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2257 (FGF12)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2257 (FGF12)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2257 (FGF12)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2257 (FGF12)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2257 (FGF12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P61328(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3q28-q29
AA seq 243 aa AA seqDB search
MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKR
PVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQG
VKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKE
GQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQ
DST
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggcgatagccagctccttgatccggcagaagcggcaggcgagggagtccaac
agcgaccgagtgtcggcctccaagcgccgctccagccccagcaaagacgggcgctccctg
tgcgagaggcacgtcctcggggtgttcagcaaagtgcgcttctgcagcggccgcaagagg
ccggtgaggcggagaccagaaccccagctcaaagggattgtgacaaggttattcagccag
cagggatacttcctgcagatgcacccagatggtaccattgatgggaccaaggacgaaaac
agcgactacactctcttcaatctaattcccgtgggcctgcgtgtagtggccatccaagga
gtgaaggctagcctctatgtggccatgaatggtgaaggctatctctacagttcagatgtt
ttcactccagaatgcaaattcaaggaatctgtgtttgaaaactactatgtgatctattct
tccacactgtaccgccagcaagaatcaggccgagcttggtttctgggactcaataaagaa
ggtcaaattatgaaggggaacagagtgaagaaaaccaagccctcatcacattttgtaccg
aaacctattgaagtgtgtatgtacagagaaccatcgctacatgaaattggagaaaaacaa
gggcgttcaaggaaaagttctggaacaccaaccatgaatggaggcaaagttgtgaatcaa
gattcaacatag

KEGG   Homo sapiens (human): 2258Help
Entry
2258              CDS       T01001                                 

Gene name
FGF13, FGF-13, FGF2, FHF-2, FHF2
Definition
(RefSeq) fibroblast growth factor 13
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2258 (FGF13)
   04015 Rap1 signaling pathway
    2258 (FGF13)
   04010 MAPK signaling pathway
    2258 (FGF13)
   04151 PI3K-Akt signaling pathway
    2258 (FGF13)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2258 (FGF13)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2258 (FGF13)
   05218 Melanoma
    2258 (FGF13)
   05224 Breast cancer
    2258 (FGF13)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2258 (FGF13)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2258 (FGF13)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2258 (FGF13)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2258 (FGF13)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2258 (FGF13)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2258 (FGF13)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2258 (FGF13)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2258 (FGF13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q92913(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
Xq26.3-q27.1
AA seq 245 aa AA seqDB search
MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRR
RPEPQLKGIVTKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK
LYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIM
KGNHVKKNKPAAHFLPKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMS
HNEST
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctatcgccagctcgctcatccgtcagaagaggcaagcccgcgagcgcgag
aaatccaacgcctgcaagtgtgtcagcagccccagcaaaggcaagaccagctgcgacaaa
aacaagttaaatgtcttttcccgggtcaaactcttcggctccaagaagaggcgcagaaga
agaccagagcctcagcttaagggtatagttaccaagctatacagccgacaaggctaccac
ttgcagctgcaggcggatggaaccattgatggcaccaaagatgaggacagcacttacact
ctgtttaacctcatccctgtgggtctgcgagtggtggctatccaaggagttcaaaccaag
ctgtacttggcaatgaacagtgagggatacttgtacacctcggaacttttcacacctgag
tgcaaattcaaagaatcagtgtttgaaaattattatgtgacatattcatcaatgatatac
cgtcagcagcagtcaggccgagggtggtatctgggtctgaacaaagaaggagagatcatg
aaaggcaaccatgtgaagaagaacaagcctgcagctcattttctgcctaaaccactgaaa
gtggccatgtacaaggagccatcactgcacgatctcacggagttctcccgatctggaagc
gggaccccaaccaagagcagaagtgtctctggcgtgctgaacggaggcaaatccatgagc
cacaatgaatcaacgtag

KEGG   Homo sapiens (human): 2259Help
Entry
2259              CDS       T01001                                 

Gene name
FGF14, FGF-14, FHF-4, FHF4, SCA27
Definition
(RefSeq) fibroblast growth factor 14
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Disease
H00063  
Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2259 (FGF14)
   04015 Rap1 signaling pathway
    2259 (FGF14)
   04010 MAPK signaling pathway
    2259 (FGF14)
   04151 PI3K-Akt signaling pathway
    2259 (FGF14)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2259 (FGF14)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2259 (FGF14)
   05218 Melanoma
    2259 (FGF14)
   05224 Breast cancer
    2259 (FGF14)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2259 (FGF14)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2259 (FGF14)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2259 (FGF14)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2259 (FGF14)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2259 (FGF14)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2259 (FGF14)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2259 (FGF14)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2259 (FGF14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q92915(Tbio)
UniProt: 
Position
13q33.1
AA seq 247 aa AA seqDB search
MAAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRR
LRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVK
TGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQ
AMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKP
VNKSKTT
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccatcgctagcggcttgatccgccagaagcggcaggcgcgggagcagcac
tgggaccggccgtctgccagcaggaggcggagcagccccagcaagaaccgcgggctctgc
aacggcaacctggtggatatcttctccaaagtgcgcatcttcggcctcaagaagcgcagg
ttgcggcgccaagatccccagctcaagggtatagtgaccaggttatattgcaggcaaggc
tactacttgcaaatgcaccccgatggagctctcgatggaaccaaggatgacagcactaat
tctacactcttcaacctcataccagtgggactacgtgttgttgccatccagggagtgaaa
acagggttgtatatagccatgaatggagaaggttacctctacccatcagaactttttacc
cctgaatgcaagtttaaagaatctgtttttgaaaattattatgtaatctactcatccatg
ttgtacagacaacaggaatctggtagagcctggtttttgggattaaataaggaagggcaa
gctatgaaagggaacagagtaaagaaaaccaaaccagcagctcattttctacccaagcca
ttggaagttgccatgtaccgagaaccatctttgcatgatgttggggaaacggtcccgaag
cctggggtgacgccaagtaaaagcacaagtgcgtctgcaataatgaatggaggcaaacca
gtcaacaagagtaagacaacatag

KEGG   Homo sapiens (human): 26281Help
Entry
26281             CDS       T01001                                 

Gene name
FGF20, FGF-20, RHDA2
Definition
(RefSeq) fibroblast growth factor 20
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Disease
H01728  
Potter syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    26281 (FGF20)
   04015 Rap1 signaling pathway
    26281 (FGF20)
   04010 MAPK signaling pathway
    26281 (FGF20)
   04151 PI3K-Akt signaling pathway
    26281 (FGF20)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    26281 (FGF20)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    26281 (FGF20)
   05218 Melanoma
    26281 (FGF20)
   05224 Breast cancer
    26281 (FGF20)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   26281 (FGF20)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     26281 (FGF20)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     26281 (FGF20)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     26281 (FGF20)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     26281 (FGF20)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   26281 (FGF20)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   26281 (FGF20)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   26281 (FGF20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9NP95(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
8p22
AA seq 211 aa AA seqDB search
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLMYT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctcccttagccgaagtcgggggctttctgggcggcctggagggcttgggccagcag
gtgggttcgcatttcctgttgcctcctgccggggagcggccgccgctgctgggcgagcgc
aggagcgcggcggagcggagcgcgcgcggcgggccgggggctgcgcagctggcgcacctg
cacggcatcctgcgccgccggcagctctattgccgcaccggcttccacctgcagatcctg
cccgacggcagcgtgcagggcacccggcaggaccacagcctcttcggtatcttggaattc
atcagtgtggcagtgggactggtcagtattagaggtgtggacagtggtctctatcttgga
atgaatgacaaaggagaactctatggatcagagaaacttacttccgaatgcatctttagg
gagcagtttgaagagaactggtataacacctattcatctaacatatataaacatggagac
actggccgcaggtattttgtggcacttaacaaagacggaactccaagagatggcgccagg
tccaagaggcatcagaaatttacacatttcttacctagaccagtggatccagaaagagtt
ccagaattgtacaaggacctactgatgtacacttga

KEGG   Homo sapiens (human): 26291Help
Entry
26291             CDS       T01001                                 

Gene name
FGF21
Definition
(RefSeq) fibroblast growth factor 21
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    26291 (FGF21)
   04015 Rap1 signaling pathway
    26291 (FGF21)
   04010 MAPK signaling pathway
    26291 (FGF21)
   04151 PI3K-Akt signaling pathway
    26291 (FGF21)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    26291 (FGF21)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    26291 (FGF21)
   05218 Melanoma
    26291 (FGF21)
   05224 Breast cancer
    26291 (FGF21)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   26291 (FGF21)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     26291 (FGF21)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     26291 (FGF21)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     26291 (FGF21)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     26291 (FGF21)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   26291 (FGF21)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   26291 (FGF21)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   26291 (FGF21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9NSA1(Tbio)
UniProt: 
Position
19q13.33
AA seq 209 aa AA seqDB search
MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAH
LEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGI
LAPQPPDVGSSDPLSMVGPSQGRSPSYAS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggactcggacgagaccgggttcgagcactcaggactgtgggtttctgtgctggctggt
cttctgctgggagcctgccaggcacaccccatccctgactccagtcctctcctgcaattc
gggggccaagtccggcagcggtacctctacacagatgatgcccagcagacagaagcccac
ctggagatcagggaggatgggacggtggggggcgctgctgaccagagccccgaaagtctc
ctgcagctgaaagccttgaagccgggagttattcaaatcttgggagtcaagacatccagg
ttcctgtgccagcggccagatggggccctgtatggatcgctccactttgaccctgaggcc
tgcagcttccgggagctgcttcttgaggacggatacaatgtttaccagtccgaagcccac
ggcctcccgctgcacctgccagggaacaagtccccacaccgggaccctgcaccccgagga
ccagctcgcttcctgccactaccaggcctgccccccgcactcccggagccacccggaatc
ctggccccccagccccccgatgtgggctcctcggaccctctgagcatggtgggaccttcc
cagggccgaagccccagctacgcttcctga

KEGG   Homo sapiens (human): 27006Help
Entry
27006             CDS       T01001                                 

Gene name
FGF22
Definition
(RefSeq) fibroblast growth factor 22
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    27006 (FGF22)
   04015 Rap1 signaling pathway
    27006 (FGF22)
   04010 MAPK signaling pathway
    27006 (FGF22)
   04151 PI3K-Akt signaling pathway
    27006 (FGF22)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    27006 (FGF22)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    27006 (FGF22)
   05218 Melanoma
    27006 (FGF22)
   05224 Breast cancer
    27006 (FGF22)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   27006 (FGF22)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     27006 (FGF22)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     27006 (FGF22)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     27006 (FGF22)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     27006 (FGF22)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   27006 (FGF22)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   27006 (FGF22)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   27006 (FGF22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9HCT0(Tbio)
UniProt: 
Position
19p13.3
AA seq 170 aa AA seqDB search
MRRRLWLGLAWLLLARAPDAAGTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGR
VQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIE
ENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgccgcctgtggctgggcctggcctggctgctgctggcgcgggcgccggacgcc
gcgggaaccccgagcgcgtcgcggggaccgcgcagctacccgcacctggagggcgacgtg
cgctggcggcgcctcttctcctccactcacttcttcctgcgcgtggatcccggcggccgc
gtgcagggcacccgctggcgccacggccaggacagcatcctggagatccgctctgtacac
gtgggcgtcgtggtcatcaaagcagtgtcctcaggcttctacgtggccatgaaccgccgg
ggccgcctctacgggtcgcgactctacaccgtggactgcaggttccgggagcgcatcgaa
gagaacggccacaacacctacgcctcacagcgctggcgccgccgcggccagcccatgttc
ctggcgctggacaggaggggggggccccggccaggcggccggacgcggcggtaccacctg
tccgcccacttcctgcccgtcctggtctcctga

KEGG   Homo sapiens (human): 8074Help
Entry
8074              CDS       T01001                                 

Gene name
FGF23, ADHR, FGFN, HPDR2, HYPF, PHPTC
Definition
(RefSeq) fibroblast growth factor 23
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Disease
H00214  
Hypophosphatemic rickets
H01193  
Familial tumoral calcinosis (FTC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    8074 (FGF23)
   04015 Rap1 signaling pathway
    8074 (FGF23)
   04010 MAPK signaling pathway
    8074 (FGF23)
   04151 PI3K-Akt signaling pathway
    8074 (FGF23)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    8074 (FGF23)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8074 (FGF23)
   05218 Melanoma
    8074 (FGF23)
   05224 Breast cancer
    8074 (FGF23)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   8074 (FGF23)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     8074 (FGF23)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     8074 (FGF23)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     8074 (FGF23)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     8074 (FGF23)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   8074 (FGF23)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   8074 (FGF23)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   8074 (FGF23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9GZV9(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
12p13.32
AA seq 251 aa AA seqDB search
MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL
ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRS
AEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTG
PEGCRPFAKFI
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgttgggggcccgcctcaggctctgggtctgtgccttgtgcagcgtctgcagcatgagc
gtcctcagagcctatcccaatgcctccccactgctcggctccagctggggtggcctgatc
cacctgtacacagccacagccaggaacagctaccacctgcagatccacaagaatggccat
gtggatggcgcaccccatcagaccatctacagtgccctgatgatcagatcagaggatgct
ggctttgtggtgattacaggtgtgatgagcagaagatacctctgcatggatttcagaggc
aacatttttggatcacactatttcgacccggagaactgcaggttccaacaccagacgctg
gaaaacgggtacgacgtctaccactctcctcagtatcacttcctggtcagtctgggccgg
gcgaagagagccttcctgccaggcatgaacccacccccgtactcccagttcctgtcccgg
aggaacgagatccccctaattcacttcaacacccccataccacggcggcacacccggagc
gccgaggacgactcggagcgggaccccctgaacgtgctgaagccccgggcccggatgacc
ccggccccggcctcctgttcacaggagctcccgagcgccgaggacaacagcccgatggcc
agtgacccattaggggtggtcaggggcggtcgagtgaacacgcacgctgggggaacgggc
ccggaaggctgccgccccttcgccaagttcatctag

KEGG   Homo sapiens (human): 8817Help
Entry
8817              CDS       T01001                                 

Gene name
FGF18, FGF-18, ZFGF5
Definition
(RefSeq) fibroblast growth factor 18
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    8817 (FGF18)
   04015 Rap1 signaling pathway
    8817 (FGF18)
   04010 MAPK signaling pathway
    8817 (FGF18)
   04151 PI3K-Akt signaling pathway
    8817 (FGF18)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    8817 (FGF18)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8817 (FGF18)
   05218 Melanoma
    8817 (FGF18)
   05224 Breast cancer
    8817 (FGF18)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   8817 (FGF18)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     8817 (FGF18)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     8817 (FGF18)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     8817 (FGF18)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     8817 (FGF18)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   8817 (FGF18)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   8817 (FGF18)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   8817 (FGF18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O76093(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
5q35.1
AA seq 207 aa AA seqDB search
MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
GQPELQKPFKYTTVTKRSRRIRPTHPA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtattcagcgccctccgcctgcacttgcctgtgtttacacttcctgctgctgtgcttc
caggtacaggtgctggttgccgaggagaacgtggacttccgcatccacgtggagaaccag
acgcgggctcgggacgatgtgagccgtaagcagctgcggctgtaccagctctacagccgg
accagtgggaaacacatccaggtcctgggccgcaggatcagtgcccgcggcgaggatggg
gacaagtatgcccagctcctagtggagacagacaccttcggtagtcaagtccggatcaag
ggcaaggagacggaattctacctgtgcatgaaccgcaaaggcaagctcgtggggaagccc
gatggcaccagcaaggagtgtgtgttcatcgagaaggttctggagaacaactacacggcc
ctgatgtcggctaagtactccggctggtacgtgggcttcaccaagaaggggcggccgcgg
aagggccccaagacccgggagaaccagcaggacgtgcatttcatgaagcgctaccccaag
gggcagccggagcttcagaagcccttcaagtacacgacggtgaccaagaggtcccgtcgg
atccggcccacacaccctgcctag

KEGG   Homo sapiens (human): 8822Help
Entry
8822              CDS       T01001                                 

Gene name
FGF17, FGF-13, FGF-17, HH20
Definition
(RefSeq) fibroblast growth factor 17
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Disease
H00255  
Hypogonadotropic hypogonadism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    8822 (FGF17)
   04015 Rap1 signaling pathway
    8822 (FGF17)
   04010 MAPK signaling pathway
    8822 (FGF17)
   04151 PI3K-Akt signaling pathway
    8822 (FGF17)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    8822 (FGF17)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8822 (FGF17)
   05218 Melanoma
    8822 (FGF17)
   05224 Breast cancer
    8822 (FGF17)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   8822 (FGF17)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     8822 (FGF17)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     8822 (FGF17)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     8822 (FGF17)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     8822 (FGF17)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   8822 (FGF17)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   8822 (FGF17)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   8822 (FGF17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O60258(Tbio)
UniProt: 
Position
8p21.3
AA seq 216 aa AA seqDB search
MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSR
TSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKP
SGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQ
GQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgggagccgcccgcctgctgcccaacctcactctgtgcttacagctgctgattctctgc
tgtcaaactcagggggagaatcacccgtctcctaattttaaccagtacgtgagggaccag
ggcgccatgaccgaccagctgagcaggcggcagatccgcgagtaccaactctacagcagg
accagtggcaagcacgtgcaggtcaccgggcgtcgcatctccgccaccgccgaggacggc
aacaagtttgccaagctcatagtggagacggacacgtttggcagccgggttcgcatcaaa
ggggctgagagtgagaagtacatctgtatgaacaagaggggcaagctcatcgggaagccc
agcgggaagagcaaagactgcgtgttcacggagatcgtgctggagaacaactatacggcc
ttccagaacgcccggcacgagggctggttcatggccttcacgcggcaggggcggccccgc
caggcttcccgcagccgccagaaccagcgcgaggcccacttcatcaagcgcctctaccaa
ggccagctgcccttccccaaccacgccgagaagcagaagcagttcgagtttgtgggctcc
gcccccacccgccggaccaagcgcacacggcggccccagcccctcacgtag

KEGG   Homo sapiens (human): 8823Help
Entry
8823              CDS       T01001                                 

Gene name
FGF16, FGF-16, MF4
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    8823 (FGF16)
   04015 Rap1 signaling pathway
    8823 (FGF16)
   04010 MAPK signaling pathway
    8823 (FGF16)
   04151 PI3K-Akt signaling pathway
    8823 (FGF16)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    8823 (FGF16)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8823 (FGF16)
   05218 Melanoma
    8823 (FGF16)
   05224 Breast cancer
    8823 (FGF16)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   8823 (FGF16)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     8823 (FGF16)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     8823 (FGF16)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     8823 (FGF16)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     8823 (FGF16)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   8823 (FGF16)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   8823 (FGF16)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   8823 (FGF16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O43320(Tbio)
UniProt: 
Position
Xq21.1
AA seq 207 aa AA seqDB search
MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFHYR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtggggggcgtcttcgcctccttggactgggatctacacggcttctcctcg
tctctggggaacgtgcccttagctgactccccaggtttcctgaacgagcgcctgggccaa
atcgaggggaagctgcagcgtggctcacccacagacttcgcccacctaaaggggatcctg
cggcgccgccagctctactgccgcaccggcttccacctggagatcttccccaacggcacg
gtgcacgggacccgccacgaccacagccgcttcggaatcctggagtttatcagcctggct
gtggggctgatcagcatccggggagtggactctggcctgtacctaggaatgaatgagcga
ggagaactctatgggtcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaa
gaaaactggtacaacacctatgcctcaaccttgtacaaacattcggactcagagagacag
tattacgtggccctgaacaaagatggctcaccccgggagggatacaggactaaacgacac
cagaaattcactcactttttacccaggcctgtagatccttctaagttgccctccatgtcc
agagacctctttcactataggtaa

KEGG   Homo sapiens (human): 9965Help
Entry
9965              CDS       T01001                                 

Gene name
FGF19
Definition
(RefSeq) fibroblast growth factor 19
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    9965 (FGF19)
   04015 Rap1 signaling pathway
    9965 (FGF19)
   04010 MAPK signaling pathway
    9965 (FGF19)
   04151 PI3K-Akt signaling pathway
    9965 (FGF19)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    9965 (FGF19)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    9965 (FGF19)
   05218 Melanoma
    9965 (FGF19)
   05224 Breast cancer
    9965 (FGF19)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   9965 (FGF19)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     9965 (FGF19)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     9965 (FGF19)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     9965 (FGF19)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     9965 (FGF19)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   9965 (FGF19)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   9965 (FGF19)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   9965 (FGF19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O95750(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.3
AA seq 216 aa AA seqDB search
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFL
RIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDC
AFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLR
GHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcggagcgggtgtgtggtggtccacgtatggatcctggccggcctctggctggccgtg
gccgggcgccccctcgccttctcggacgcggggccccacgtgcactacggctggggcgac
cccatccgcctgcggcacctgtacacctccggcccccacgggctctccagctgcttcctg
cgcatccgtgccgacggcgtcgtggactgcgcgcggggccagagcgcgcacagtttgctg
gagatcaaggcagtcgctctgcggaccgtggccatcaagggcgtgcacagcgtgcggtac
ctctgcatgggcgccgacggcaagatgcaggggctgcttcagtactcggaggaagactgt
gctttcgaggaggagatccgcccagatggctacaatgtgtaccgatccgagaagcaccgc
ctcccggtctccctgagcagtgccaaacagcggcagctgtacaagaacagaggctttctt
ccactctctcatttcctgcccatgctgcccatggtcccagaggagcctgaggacctcagg
ggccacttggaatctgacatgttctcttcgcccctggagaccgacagcatggacccattt
gggcttgtcaccggactggaggccgtgaggagtcccagctttgagaagtaa

DBGET integrated database retrieval system