KEGG   Homo sapiens (human): 2249Help
Entry
2249              CDS       T01001                                 

Gene name
FGF4, HBGF-4, HST, HST-1, HSTF1, K-FGF, KFGF
Definition
fibroblast growth factor 4
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2249 (FGF4)
   04015 Rap1 signaling pathway
    2249 (FGF4)
   04010 MAPK signaling pathway
    2249 (FGF4)
   04151 PI3K-Akt signaling pathway
    2249 (FGF4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2249 (FGF4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2249 (FGF4)
   05218 Melanoma
    2249 (FGF4)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  2249 (FGF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.3
AA seq 206 aa AA seqDB search
MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPV
AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP
VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIA
LSKNGKTKKGNRVSPTMKVTHFLPRL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggcccgggacggccgcggtagcgctgctcccggcggtcctgctggccttgctg
gcgccctgggcgggccgagggggcgccgccgcacccactgcacccaacggcacgctggag
gccgagctggagcgccgctgggagagcctggtggcgctctcgttggcgcgcctgccggtg
gcagcgcagcccaaggaggcggccgtccagagcggcgccggcgactacctgctgggcatc
aagcggctgcggcggctctactgcaacgtgggcatcggcttccacctccaggcgctcccc
gacggccgcatcggcggcgcgcacgcggacacccgcgacagcctgctggagctctcgccc
gtggagcggggcgtggtgagcatcttcggcgtggccagccggttcttcgtggccatgagc
agcaagggcaagctctatggctcgcccttcttcaccgatgagtgcacgttcaaggagatt
ctccttcccaacaactacaacgcctacgagtcctacaagtaccccggcatgttcatcgcc
ctgagcaagaatgggaagaccaagaaggggaaccgagtgtcgcccaccatgaaggtcacc
cacttcctccccaggctgtga

DBGET integrated database retrieval system