KEGG   Homo sapiens (human): 2250Help
Entry
2250              CDS       T01001                                 

Gene name
FGF5, HBGF-5, Smag-82, TCMGLY
Definition
(RefSeq) fibroblast growth factor 5
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2250 (FGF5)
   04015 Rap1 signaling pathway
    2250 (FGF5)
   04010 MAPK signaling pathway
    2250 (FGF5)
   04151 PI3K-Akt signaling pathway
    2250 (FGF5)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2250 (FGF5)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2250 (FGF5)
   05218 Melanoma
    2250 (FGF5)
   05224 Breast cancer
    2250 (FGF5)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2250 (FGF5)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2250 (FGF5)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2250 (FGF5)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2250 (FGF5)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2250 (FGF5)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2250 (FGF5)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2250 (FGF5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2250 (FGF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P12034(Tbio)
UniProt: 
Position
4q21.21
AA seq 268 aa AA seqDB search
MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSAS
SSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSV
LEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHR
TEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPP
SPIKPKIPLSAPRKNTNSVKYRLKFRFG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgtccttcctcctcctcctcttcttcagccacctgatcctcagcgcctgggct
cacggggagaagcgtctcgcccccaaagggcaacccggacccgctgccactgataggaac
cctagaggctccagcagcagacagagcagcagtagcgctatgtcttcctcttctgcctcc
tcctcccccgcagcttctctgggcagccaaggaagtggcttggagcagagcagtttccag
tggagcccctcggggcgccggaccggcagcctctactgcagagtgggcatcggtttccat
ctgcagatctacccggatggcaaagtcaatggatcccacgaagccaatatgttaagtgtt
ttggaaatatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaacaaa
tttttagcgatgtcaaaaaaaggaaaactccatgcaagtgccaagttcacagatgactgc
aagttcagggagcgttttcaagaaaatagctataatacctatgcctcagcaatacataga
actgaaaaaacagggcgggagtggtatgtggccctgaataaaagaggaaaagccaaacga
gggtgcagcccccgggttaaaccccagcatatctctacccattttctgccaagattcaag
cagtcggagcagccagaactttctttcacggttactgttcctgaaaagaaaaagccacct
agccctatcaagccaaagattcccctttctgcacctcggaaaaataccaactcagtgaaa
tacagactcaagtttcgctttggataa

DBGET integrated database retrieval system