KEGG   Homo sapiens (human): 2250Help
Entry
2250              CDS       T01001                                 

Gene name
FGF5, HBGF-5, Smag-82
Definition
fibroblast growth factor 5
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Melanoma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Melanoma [PATH:hsa05218]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21
AA seq 268 aa AA seqDB search
MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSAS
SSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSV
LEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHR
TEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPP
SPIKPKIPLSAPRKNTNSVKYRLKFRFG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgtccttcctcctcctcctcttcttcagccacctgatcctcagcgcctgggct
cacggggagaagcgtctcgcccccaaagggcaacccggacccgctgccactgataggaac
cctagaggctccagcagcagacagagcagcagtagcgctatgtcttcctcttctgcctcc
tcctcccccgcagcttctctgggcagccaaggaagtggcttggagcagagcagtttccag
tggagcccctcggggcgccggaccggcagcctctactgcagagtgggcatcggtttccat
ctgcagatctacccggatggcaaagtcaatggatcccacgaagccaatatgttaagtgtt
ttggaaatatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaacaaa
tttttagcgatgtcaaaaaaaggaaaactccatgcaagtgccaagttcacagatgactgc
aagttcagggagcgttttcaagaaaatagctataatacctatgcctcagcaatacataga
actgaaaaaacagggcgggagtggtatgtggccctgaataaaagaggaaaagccaaacga
gggtgcagcccccgggttaaaccccagcatatctctacccattttctgccaagattcaag
cagtcggagcagccagaactttctttcacggttactgttcctgaaaagaaaaagccacct
agccctatcaagccaaagattcccctttctgcacctcggaaaaataccaactcagtgaaa
tacagactcaagtttcgctttggataa

DBGET integrated database retrieval system