KEGG   Homo sapiens (human): 2251Help
Entry
2251              CDS       T01001                                 

Gene name
FGF6, HBGF-6, HST2
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2251 (FGF6)
   04015 Rap1 signaling pathway
    2251 (FGF6)
   04010 MAPK signaling pathway
    2251 (FGF6)
   04151 PI3K-Akt signaling pathway
    2251 (FGF6)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2251 (FGF6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2251 (FGF6)
   05226 Gastric cancer
    2251 (FGF6)
   05218 Melanoma
    2251 (FGF6)
   05224 Breast cancer
    2251 (FGF6)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2251 (FGF6)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2251 (FGF6)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2251 (FGF6)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2251 (FGF6)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2251 (FGF6)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2251 (FGF6)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2251 (FGF6)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2251 (FGF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF
Motif
Other DBs
NCBI-GeneID: 2251
NCBI-ProteinID: NP_066276
OMIM: 134921
HGNC: 3684
Ensembl: ENSG00000111241
Vega: OTTHUMG00000168242
Pharos: P10767(Tbio)
UniProt: P10767
Position
12p13.32
AA seq 208 aa AA seqDB search
MALGQKLFITMSRGAGRLQGTLWALVFLGILVGMVVPSPAGTRANNTLLDSRGWGTLLSR
SRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGRISGTHEENPYSLLEI
STVERGVVSLFGVRSALFVAMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYQGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccctgggacagaaactgttcatcactatgtcccggggagcaggacgtctgcagggc
acgctgtgggctctcgtcttcctaggcatcctagtgggcatggtggtgccctcgcctgca
ggcacccgtgccaacaacacgctgctggactcgaggggctggggcaccctgctgtccagg
tctcgcgccgggctagctggagagattgccggggtgaactgggaaagtggctatttggtg
gggatcaagcggcagcggaggctctactgcaacgtgggcatcggctttcacctccaggtg
ctccccgacggccggatcagcgggacccacgaggagaacccctacagcctgctggaaatt
tccactgtggagcgaggcgtggtgagtctctttggagtgagaagtgccctcttcgttgcc
atgaacagtaaaggaagattgtacgcaacgcccagcttccaagaagaatgcaagttcaga
gaaaccctcctgcccaacaattacaatgcctacgagtcagacttgtaccaagggacctac
attgccctgagcaaatacggacgggtaaagcggggcagcaaggtgtccccgatcatgact
gtcactcatttccttcccaggatctaa

DBGET integrated database retrieval system