KEGG   Homo sapiens (human): 2252Help
Entry
2252              CDS       T01001                                 

Gene name
FGF7, HBGF-7, KGF
Definition
fibroblast growth factor 7
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2252 (FGF7)
   04015 Rap1 signaling pathway
    2252 (FGF7)
   04010 MAPK signaling pathway
    2252 (FGF7)
   04151 PI3K-Akt signaling pathway
    2252 (FGF7)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2252 (FGF7)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2252 (FGF7)
   05218 Melanoma
    2252 (FGF7)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  2252 (FGF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
15q21.2
AA seq 194 aa AA seqDB search
MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaatggatactgacatggatcctgccaactttgctctacagatcatgctttcac
attatctgtctagtgggtactatatctttagcttgcaatgacatgactccagagcaaatg
gctacaaatgtgaactgttccagccctgagcgacacacaagaagttatgattacatggaa
ggaggggatataagagtgagaagactcttctgtcgaacacagtggtacctgaggatcgat
aaaagaggcaaagtaaaagggacccaagagatgaagaataattacaatatcatggaaatc
aggacagtggcagttggaattgtggcaatcaaaggggtggaaagtgaattctatcttgca
atgaacaaggaaggaaaactctatgcaaagaaagaatgcaatgaagattgtaacttcaaa
gaactaattctggaaaaccattacaacacatatgcatcagctaaatggacacacaacgga
ggggaaatgtttgttgccttaaatcaaaaggggattcctgtaagaggaaaaaaaacgaag
aaagaacaaaaaacagcccactttcttcctatggcaataacttaa

DBGET integrated database retrieval system