KEGG   Homo sapiens (human): 2253Help
Entry
2253              CDS       T01001                                 

Gene name
FGF8, AIGF, FGF-8, HBGF-8, HH6, KAL6
Definition
fibroblast growth factor 8 (androgen-induced)
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Melanoma
Disease
H00255  
Hypogonadotropic hypogonadism
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Melanoma [PATH:hsa05218]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24
AA seq 140 aa AA seqDB search
MAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLE
NNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLN
YPPFTRSLRGSQRTWAPEPR
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggacggcgaccccttcgcaaagctcatcgtggagacggacacctttggaagc
agagttcgagtccgaggagccgagacgggcctctacatctgcatgaacaagaaggggaag
ctgatcgccaagagcaacggcaaaggcaaggactgcgtcttcacggagattgtgctggag
aacaactacacagcgctgcagaatgccaagtacgagggctggtacatggccttcacccgc
aagggccggccccgcaagggctccaagacgcggcagcaccagcgtgaggtccacttcatg
aagcggctgccccggggccaccacaccaccgagcagagcctgcgcttcgagttcctcaac
tacccgcccttcacgcgcagcctgcgcggcagccagaggacttgggcccccgagccccga
tag

DBGET integrated database retrieval system