KEGG   Homo sapiens (human): 2253Help
Entry
2253              CDS       T01001                                 

Gene name
FGF8, AIGF, FGF-8, HBGF-8, HH6, KAL6
Definition
(RefSeq) fibroblast growth factor 8 (androgen-induced)
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Disease
H00255  
Hypogonadotropic hypogonadism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2253 (FGF8)
   04015 Rap1 signaling pathway
    2253 (FGF8)
   04010 MAPK signaling pathway
    2253 (FGF8)
   04151 PI3K-Akt signaling pathway
    2253 (FGF8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2253 (FGF8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2253 (FGF8)
   05218 Melanoma
    2253 (FGF8)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2253 (FGF8)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2253 (FGF8)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2253 (FGF8)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2253 (FGF8)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2253 (FGF8)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2253 (FGF8)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2253 (FGF8)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2253 (FGF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24
AA seq 140 aa AA seqDB search
MAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLE
NNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLN
YPPFTRSLRGSQRTWAPEPR
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggacggcgaccccttcgcaaagctcatcgtggagacggacacctttggaagc
agagttcgagtccgaggagccgagacgggcctctacatctgcatgaacaagaaggggaag
ctgatcgccaagagcaacggcaaaggcaaggactgcgtcttcacggagattgtgctggag
aacaactacacagcgctgcagaatgccaagtacgagggctggtacatggccttcacccgc
aagggccggccccgcaagggctccaagacgcggcagcaccagcgtgaggtccacttcatg
aagcggctgccccggggccaccacaccaccgagcagagcctgcgcttcgagttcctcaac
tacccgcccttcacgcgcagcctgcgcggcagccagaggacttgggcccccgagccccga
tag

DBGET integrated database retrieval system