KEGG   Homo sapiens (human): 2255Help
Entry
2255              CDS       T01001                                 

Gene name
FGF10
Definition
fibroblast growth factor 10
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Disease
H00642  
Lacrimo-auriculo-dento-digital syndrome (LADD)
H00677  
Aplasia of lacrimal and salivary glands
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2255 (FGF10)
   04015 Rap1 signaling pathway
    2255 (FGF10)
   04010 MAPK signaling pathway
    2255 (FGF10)
   04151 PI3K-Akt signaling pathway
    2255 (FGF10)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2255 (FGF10)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2255 (FGF10)
   05218 Melanoma
    2255 (FGF10)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  2255 (FGF10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p13-p12
AA seq 208 aa AA seqDB search
MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSP
SSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGV
VAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVAL
NGKGAPRRGQKTRRKNTSAHFLPMVVHS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaatggatactgacacattgtgcctcagcctttccccacctgcccggctgctgc
tgctgctgctttttgttgctgttcttggtgtcttccgtccctgtcacctgccaagccctt
ggtcaggacatggtgtcaccagaggccaccaactcttcttcctcctccttctcctctcct
tccagcgcgggaaggcatgtgcggagctacaatcaccttcaaggagatgtccgctggaga
aagctattctctttcaccaagtactttctcaagattgagaagaacgggaaggtcagcggg
accaagaaggagaactgcccgtacagcatcctggagataacatcagtagaaatcggagtt
gttgccgtcaaagccattaacagcaactattacttagccatgaacaagaaggggaaactc
tatggctcaaaagaatttaacaatgactgtaagctgaaggagaggatagaggaaaatgga
tacaatacctatgcatcatttaactggcagcataatgggaggcaaatgtatgtggcattg
aatggaaaaggagctccaaggagaggacagaaaacacgaaggaaaaacacctctgctcac
tttcttccaatggtggtacactcatag

DBGET integrated database retrieval system