KEGG   Homo sapiens (human): 2256Help
Entry
2256              CDS       T01001                                 

Gene name
FGF11, FHF3
Definition
fibroblast growth factor 11
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Melanoma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Melanoma [PATH:hsa05218]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 225 aa AA seqDB search
MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARP
DRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAK
LGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQ
VMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctggccagtagcctgatccggcagaagcgggaggtccgcgagcccgggggc
agccggccggtgtcggcgcagcggcgcgtgtgtccccgcggcaccaagtccctttgccag
aagcagctcctcatcctgctgtccaaggtgcgactgtgcggggggcggcccgcgcggccg
gaccgcggcccggagcctcagctcaaaggcatcgtcaccaaactgttctgccgccagggt
ttctacctccaggcgaatcccgacggaagcatccagggcaccccagaggataccagctcc
ttcacccacttcaacctgatccctgtgggcctccgtgtggtcaccatccagagcgccaag
ctgggtcactacatggccatgaatgctgagggactgctctacagttcgccgcatttcaca
gctgagtgtcgctttaaggagtgtgtctttgagaattactacgtcctgtacgcctctgct
ctctaccgccagcgtcgttctggccgggcctggtacctcggcctggacaaggagggccag
gtcatgaagggaaaccgagttaagaagaccaaggcagctgcccactttctgcccaagctc
ctggaggtggccatgtaccaggagccttctctccacagtgtccccgaggcctccccttcc
agtccccctgccccctga

DBGET integrated database retrieval system