KEGG   Homo sapiens (human): 2256Help
Entry
2256              CDS       T01001                                 

Gene name
FGF11, FGF-11, FHF-3, FHF3
Definition
(RefSeq) fibroblast growth factor 11
  KO
K22413  fibroblast growth factor 11/12/13/14
Organism
hsa  Homo sapiens (human)
Brite
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2256 (FGF11)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2256 (FGF11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF Fascin
Motif
Other DBs
NCBI-GeneID: 2256
NCBI-ProteinID: NP_004103
OMIM: 601514
HGNC: 3667
Ensembl: ENSG00000161958
Vega: OTTHUMG00000108136
Pharos: Q92914(Tdark)
UniProt: Q92914
Position
17p13.1
AA seq 225 aa AA seqDB search
MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARP
DRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAK
LGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQ
VMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctggccagtagcctgatccggcagaagcgggaggtccgcgagcccgggggc
agccggccggtgtcggcgcagcggcgcgtgtgtccccgcggcaccaagtccctttgccag
aagcagctcctcatcctgctgtccaaggtgcgactgtgcggggggcggcccgcgcggccg
gaccgcggcccggagcctcagctcaaaggcatcgtcaccaaactgttctgccgccagggt
ttctacctccaggcgaatcccgacggaagcatccagggcaccccagaggataccagctcc
ttcacccacttcaacctgatccctgtgggcctccgtgtggtcaccatccagagcgccaag
ctgggtcactacatggccatgaatgctgagggactgctctacagttcgccgcatttcaca
gctgagtgtcgctttaaggagtgtgtctttgagaattactacgtcctgtacgcctctgct
ctctaccgccagcgtcgttctggccgggcctggtacctcggcctggacaaggagggccag
gtcatgaagggaaaccgagttaagaagaccaaggcagctgcccactttctgcccaagctc
ctggaggtggccatgtaccaggagccttctctccacagtgtccccgaggcctccccttcc
agtccccctgccccctga

DBGET integrated database retrieval system