KEGG   Homo sapiens (human): 2256Help
Entry
2256              CDS       T01001                                 

Gene name
FGF11, FGF-11, FHF-3, FHF3
Definition
(RefSeq) fibroblast growth factor 11
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2256 (FGF11)
   04015 Rap1 signaling pathway
    2256 (FGF11)
   04010 MAPK signaling pathway
    2256 (FGF11)
   04151 PI3K-Akt signaling pathway
    2256 (FGF11)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2256 (FGF11)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2256 (FGF11)
   05218 Melanoma
    2256 (FGF11)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2256 (FGF11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 166 aa AA seqDB search
MSLSPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSA
KLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEG
QVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgtctctctctccagagcctcagctcaaaggcatcgtcaccaaactgttctgccgccag
ggtttctacctccaggcgaatcccgacggaagcatccagggcaccccagaggataccagc
tccttcacccacttcaacctgatccctgtgggcctccgtgtggtcaccatccagagcgcc
aagctgggtcactacatggccatgaatgctgagggactgctctacagttcgccgcatttc
acagctgagtgtcgctttaaggagtgtgtctttgagaattactacgtcctgtacgcctct
gctctctaccgccagcgtcgttctggccgggcctggtacctcggcctggacaaggagggc
caggtcatgaagggaaaccgagttaagaagaccaaggcagctgcccactttctgcccaag
ctcctggaggtggccatgtaccaggagccttctctccacagtgtccccgaggcctcccct
tccagtccccctgccccctga

DBGET integrated database retrieval system