KEGG   Homo sapiens (human): 225689Help
Entry
225689            CDS       T01001                                 

Gene name
MAPK15, ERK7, ERK8
Definition
mitogen-activated protein kinase 15 (EC:2.7.11.24)
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     225689 (MAPK15)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   225689 (MAPK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8
AA seq 544 aa AA seqDB search
MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFRE
ITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQ
LLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVAT
RWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEE
DLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQ
HPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILECGGSSGTSREKGPEG
VSPSQAHLHKPRADPQLPSRTPVQGPRPRPQSSPGHDPAEHESPRAAKNVPRQNSAPLLQ
TALLGNGERPPGAKEAPPLTLSLVKPSGRGAAPSLTSQAAAQVANQALIRGDWNRGGGVR
VASVQQVPPRLPPEARPGRRMFSTSALQGAQGGARALLGGYSQAYGTVCHSALGHLPLLE
GHHV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaccgtagtggaccctcgcattgtccggagatacctactcaggcggcagctcggg
cagggggcctatggcattgtgtggaaggcagtggaccggaggactggtgaggtcgtggcc
atcaagaaaatctttgatgcttttagggataagacagatgcccagagaacattccgggaa
atcacgctcctccaggagtttggggaccatcccaacatcatcagcctccttgacgtgatc
cgggcagagaacgacagggacatttacctggtgtttgagtttatggacactgacctgaac
gcagtcatccggaagggcggcctgctgcaggacgtccacgtgcgctccatcttctaccag
ctcctgcgggccacccggttcctccactcggggcacgttgtgcaccgggaccagaagccg
tccaatgtgctcctggatgccaactgcacagtgaagctgtgtgactttggcctggcccgc
tccctgggcgacctccccgaggggcctgaggaccaggccgtgacagagtacgtggccaca
cgctggtaccgagcaccggaggtgctgctctcttcgcaccgatacacccttggggtggac
atgtggagtctgggctgtatcctgggggagatgctgcgggggagacccctgttccccggc
acgtccaccctccaccagctggagctgatcctggagaccatcccaccgccatctgaggag
gacctcctggctctcggctcaggctgccgtgcctctgtgctgcaccagctggggtcccgg
ccacgacagacgctggatgccctcctaccgccagacacctccccagaggccttggacctc
cttaggcgactcctggtgttcgccccggacaagcggttaagcgcgacccaggcactgcag
cacccctacgtgcagaggttccactgccccagcgacgagtgggcacgagaggcagatgtg
cggccccgggcacacgaaggggtccagctctctgtgcctgagtaccgcagccgcgtctat
cagatgatcctggagtgtggaggcagcagcggcacctcgagagagaagggcccggagggt
gtctccccaagccaggcacacctgcacaaacccagagccgaccctcagctgccttctagg
acacctgtgcagggtcccagacccaggccccagagcagcccaggccatgaccctgccgag
cacgagtccccccgtgcagccaagaacgttcccaggcagaactccgctcccctgctccaa
actgctctcctagggaatggggaaaggccccctggggcgaaggaagcgccccccttgaca
ctctcgctggtgaagccaagcgggaggggagctgcgccctccctgacctcccaggctgcg
gctcaggtggccaaccaggccctgatccggggtgactggaaccggggcggtggggtgagg
gtggccagcgtacaacaggtccctccccggcttcctccggaggcccggcccggccggagg
atgttcagcacctctgccttgcagggtgcccaggggggtgccagggctttgcttggaggc
tactcccaagcctacgggactgtctgccactcggcactgggccacctgcccctgctggag
gggcaccatgtgtga

DBGET integrated database retrieval system