KEGG   Homo sapiens (human): 2257Help
Entry
2257              CDS       T01001                                 

Gene name
FGF12, FGF12B, FHF1
Definition
(RefSeq) fibroblast growth factor 12
  KO
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2257 (FGF12)
   04015 Rap1 signaling pathway
    2257 (FGF12)
   04010 MAPK signaling pathway
    2257 (FGF12)
   04151 PI3K-Akt signaling pathway
    2257 (FGF12)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2257 (FGF12)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2257 (FGF12)
   05218 Melanoma
    2257 (FGF12)
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2257 (FGF12)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     2257 (FGF12)
    FGFR2; fibroblast growth factor receptor 2 [KO:K05093]
     2257 (FGF12)
    FGFR3; fibroblast growth factor receptor [KO:K05094]
     2257 (FGF12)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     2257 (FGF12)
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   2257 (FGF12)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   2257 (FGF12)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2257 (FGF12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q28
AA seq 243 aa AA seqDB search
MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKR
PVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQG
VKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKE
GQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQ
DST
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggcgatagccagctccttgatccggcagaagcggcaggcgagggagtccaac
agcgaccgagtgtcggcctccaagcgccgctccagccccagcaaagacgggcgctccctg
tgcgagaggcacgtcctcggggtgttcagcaaagtgcgcttctgcagcggccgcaagagg
ccggtgaggcggagaccagaaccccagctcaaagggattgtgacaaggttattcagccag
cagggatacttcctgcagatgcacccagatggtaccattgatgggaccaaggacgaaaac
agcgactacactctcttcaatctaattcccgtgggcctgcgtgtagtggccatccaagga
gtgaaggctagcctctatgtggccatgaatggtgaaggctatctctacagttcagatgtt
ttcactccagaatgcaaattcaaggaatctgtgtttgaaaactactatgtgatctattct
tccacactgtaccgccagcaagaatcaggccgagcttggtttctgggactcaataaagaa
ggtcaaattatgaaggggaacagagtgaagaaaaccaagccctcatcacattttgtaccg
aaacctattgaagtgtgtatgtacagagaaccatcgctacatgaaattggagaaaaacaa
gggcgttcaaggaaaagttctggaacaccaaccatgaatggaggcaaagttgtgaatcaa
gattcaacatag

DBGET integrated database retrieval system