KEGG   Homo sapiens (human): 2257Help
Entry
2257              CDS       T01001                                 

Gene name
FGF12, EIEE47, FGF12B, FHF1
Definition
(RefSeq) fibroblast growth factor 12
  KO
K22413  
fibroblast growth factor 11/12/13/14
Organism
hsa  Homo sapiens (human)
Disease
H00606  
Early infantile epileptic encephalopathy
Brite
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2257 (FGF12)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2257 (FGF12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P61328(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3q28-q29
AA seq 243 aa AA seqDB search
MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKR
PVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQG
VKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKE
GQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQ
DST
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggcgatagccagctccttgatccggcagaagcggcaggcgagggagtccaac
agcgaccgagtgtcggcctccaagcgccgctccagccccagcaaagacgggcgctccctg
tgcgagaggcacgtcctcggggtgttcagcaaagtgcgcttctgcagcggccgcaagagg
ccggtgaggcggagaccagaaccccagctcaaagggattgtgacaaggttattcagccag
cagggatacttcctgcagatgcacccagatggtaccattgatgggaccaaggacgaaaac
agcgactacactctcttcaatctaattcccgtgggcctgcgtgtagtggccatccaagga
gtgaaggctagcctctatgtggccatgaatggtgaaggctatctctacagttcagatgtt
ttcactccagaatgcaaattcaaggaatctgtgtttgaaaactactatgtgatctattct
tccacactgtaccgccagcaagaatcaggccgagcttggtttctgggactcaataaagaa
ggtcaaattatgaaggggaacagagtgaagaaaaccaagccctcatcacattttgtaccg
aaacctattgaagtgtgtatgtacagagaaccatcgctacatgaaattggagaaaaacaa
gggcgttcaaggaaaagttctggaacaccaaccatgaatggaggcaaagttgtgaatcaa
gattcaacatag

DBGET integrated database retrieval system