KEGG   Homo sapiens (human): 2258Help
Entry
2258              CDS       T01001                                 

Gene name
FGF13, FGF-13, FGF2, FHF-2, FHF2
Definition
fibroblast growth factor 13
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2258 (FGF13)
   04015 Rap1 signaling pathway
    2258 (FGF13)
   04010 MAPK signaling pathway
    2258 (FGF13)
   04151 PI3K-Akt signaling pathway
    2258 (FGF13)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2258 (FGF13)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2258 (FGF13)
   05218 Melanoma
    2258 (FGF13)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  2258 (FGF13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq26.3
AA seq 199 aa AA seqDB search
MSGKVTKPKEEKDASKEPQLKGIVTKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIP
VGLRVVAIQGVQTKLYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSG
RGWYLGLNKEGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLHDLTEFSRSGSGTPTKS
RSVSGVLNGGKSMSHNEST
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaaaggtgaccaagcccaaagaggagaaagatgcttctaaggagcctcagctt
aagggtatagttaccaagctatacagccgacaaggctaccacttgcagctgcaggcggat
ggaaccattgatggcaccaaagatgaggacagcacttacactctgtttaacctcatccct
gtgggtctgcgagtggtggctatccaaggagttcaaaccaagctgtacttggcaatgaac
agtgagggatacttgtacacctcggaacttttcacacctgagtgcaaattcaaagaatca
gtgtttgaaaattattatgtgacatattcatcaatgatataccgtcagcagcagtcaggc
cgagggtggtatctgggtctgaacaaagaaggagagatcatgaaaggcaaccatgtgaag
aagaacaagcctgcagctcattttctgcctaaaccactgaaagtggccatgtacaaggag
ccatcactgcacgatctcacggagttctcccgatctggaagcgggaccccaaccaagagc
agaagtgtctctggcgtgctgaacggaggcaaatccatgagccacaatgaatcaacgtag

DBGET integrated database retrieval system