KEGG   Homo sapiens (human): 2259Help
Entry
2259              CDS       T01001                                 

Gene name
FGF14, FGF-14, FHF-4, FHF4, SCA27
Definition
fibroblast growth factor 14
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Melanoma
Disease
H00063  
Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2259 (FGF14)
   04015 Rap1 signaling pathway
    2259 (FGF14)
   04010 MAPK signaling pathway
    2259 (FGF14)
   04151 PI3K-Akt signaling pathway
    2259 (FGF14)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2259 (FGF14)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2259 (FGF14)
   05205 Proteoglycans in cancer
    2259 (FGF14)
   05218 Melanoma
    2259 (FGF14)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  2259 (FGF14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
13q34
AA seq 247 aa AA seqDB search
MAAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRR
LRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVK
TGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQ
AMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKP
VNKSKTT
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccatcgctagcggcttgatccgccagaagcggcaggcgcgggagcagcac
tgggaccggccgtctgccagcaggaggcggagcagccccagcaagaaccgcgggctctgc
aacggcaacctggtggatatcttctccaaagtgcgcatcttcggcctcaagaagcgcagg
ttgcggcgccaagatccccagctcaagggtatagtgaccaggttatattgcaggcaaggc
tactacttgcaaatgcaccccgatggagctctcgatggaaccaaggatgacagcactaat
tctacactcttcaacctcataccagtgggactacgtgttgttgccatccagggagtgaaa
acagggttgtatatagccatgaatggagaaggttacctctacccatcagaactttttacc
cctgaatgcaagtttaaagaatctgtttttgaaaattattatgtaatctactcatccatg
ttgtacagacaacaggaatctggtagagcctggtttttgggattaaataaggaagggcaa
gctatgaaagggaacagagtaaagaaaaccaaaccagcagctcattttctacccaagcca
ttggaagttgccatgtaccgagaaccatctttgcatgatgttggggaaacggtcccgaag
cctggggtgacgccaagtaaaagcacaagtgcgtctgcaataatgaatggaggcaaacca
gtcaacaagagtaagacaacatag

DBGET integrated database retrieval system