KEGG   Homo sapiens (human): 2259Help
Entry
2259              CDS       T01001                                 

Gene name
FGF14, FGF-14, FHF-4, FHF4, SCA27
Definition
(RefSeq) fibroblast growth factor 14
  KO
K22413  fibroblast growth factor 11/12/13/14
Organism
hsa  Homo sapiens (human)
Disease
H00063  Spinocerebellar ataxia (SCA)
Brite
Cytokines [BR:hsa04052]
 PDGF family
  Beta-trefoil growth factors
   2259 (FGF14)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2259 (FGF14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF Fascin
Motif
Other DBs
NCBI-GeneID: 2259
NCBI-ProteinID: NP_004106
OMIM: 601515
HGNC: 3671
Ensembl: ENSG00000102466
Vega: OTTHUMG00000017303
Pharos: Q92915(Tbio)
UniProt: Q92915
Position
13q33.1
AA seq 247 aa AA seqDB search
MAAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRR
LRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVK
TGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQ
AMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKP
VNKSKTT
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccatcgctagcggcttgatccgccagaagcggcaggcgcgggagcagcac
tgggaccggccgtctgccagcaggaggcggagcagccccagcaagaaccgcgggctctgc
aacggcaacctggtggatatcttctccaaagtgcgcatcttcggcctcaagaagcgcagg
ttgcggcgccaagatccccagctcaagggtatagtgaccaggttatattgcaggcaaggc
tactacttgcaaatgcaccccgatggagctctcgatggaaccaaggatgacagcactaat
tctacactcttcaacctcataccagtgggactacgtgttgttgccatccagggagtgaaa
acagggttgtatatagccatgaatggagaaggttacctctacccatcagaactttttacc
cctgaatgcaagtttaaagaatctgtttttgaaaattattatgtaatctactcatccatg
ttgtacagacaacaggaatctggtagagcctggtttttgggattaaataaggaagggcaa
gctatgaaagggaacagagtaaagaaaaccaaaccagcagctcattttctacccaagcca
ttggaagttgccatgtaccgagaaccatctttgcatgatgttggggaaacggtcccgaag
cctggggtgacgccaagtaaaagcacaagtgcgtctgcaataatgaatggaggcaaacca
gtcaacaagagtaagacaacatag

DBGET integrated database retrieval system