KEGG   Homo sapiens (human): 226Help
Entry
226               CDS       T01001                                 

Gene name
ALDOA, ALDA, GSD12, HEL-S-87p
Definition
aldolase A, fructose-bisphosphate (EC:4.1.2.13)
Orthology
K01623  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
HIF-1 signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Disease
H00069  
Glycogen storage diseases (GSD)
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hsa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hsa00051]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 364 aa AA seqDB search
MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYR
QLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTN
GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHAC
TQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTF
SYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVS
NHAY
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgccctaccaatatccagcactgaccccggagcagaagaaggagctgtctgacatcgct
caccgcatcgtggcacctggcaagggcatcctggctgcagatgagtccactgggagcatt
gccaagcggctgcagtccattggcaccgagaacaccgaggagaaccggcgcttctaccgc
cagctgctgctgacagctgacgaccgcgtgaacccctgcattgggggtgtcatcctcttc
catgagacactctaccagaaggcggatgatgggcgtcccttcccccaagttatcaaatcc
aagggcggtgttgtgggcatcaaggtagacaagggcgtggtccccctggcagggacaaat
ggcgagactaccacccaagggttggatgggctgtctgagcgctgtgcccagtacaagaag
gacggagctgacttcgccaagtggcgttgtgtgctgaagattggggaacacaccccctca
gccctcgccatcatggaaaatgccaatgttctggcccgttatgccagtatctgccagcag
aatggcattgtgcccatcgtggagcctgagatcctccctgatggggaccatgacttgaag
cgctgccagtatgtgaccgagaaggtgctggctgctgtctacaaggctctgagtgaccac
cacatctacctggaaggcaccttgctgaagcccaacatggtcaccccaggccatgcttgc
actcagaagttttctcatgaggagattgccatggcgaccgtcacagcgctgcgccgcaca
gtgccccccgctgtcactgggatcaccttcctgtctggaggccagagtgaggaggaggcg
tccatcaacctcaatgccattaacaagtgccccctgctgaagccctgggccctgaccttc
tcctacggccgagccctgcaggcctctgccctgaaggcctggggcgggaagaaggagaac
ctgaaggctgcgcaggaggagtatgtcaagcgagccctggccaacagccttgcctgtcaa
ggaaagtacactccgagcggtcaggctggggctgctgccagcgagtccctcttcgtctct
aaccacgcctattaa

DBGET integrated database retrieval system