KEGG   Homo sapiens (human): 2260Help
Entry
2260              CDS       T01001                                 

Gene name
FGFR1, BFGFR, CD331, CEK, FGFBR, FGFR-1, FLG, FLT-2, FLT2, HBGFR, HH2, HRTFDS, KAL2, N-SAM, OGD, bFGF-R-1
Definition
fibroblast growth factor receptor 1 (EC:2.7.10.1)
Orthology
K04362  
fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Adherens junction
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Prostate cancer
Melanoma
Disease
H00255  
Hypogonadotropic hypogonadism
H00443  
Osteoglophonic dysplasia (OD)
H00458  
Craniosynostosis
H00516  
Isolated orofacial clefts
H01207  
Trigonocephaly
Drug target
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Melanoma [PATH:hsa05218]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p12
AA seq 820 aa AA seqDB search
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGK
PLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK
NIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVS
CAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL
PVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKP
SNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPD
TRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacactctgcacc
gctaggccgtccccgaccttgcctgaacaagcccagccctggggagcccctgtggaagtg
gagtccttcctggtccaccccggtgacctgctgcagcttcgctgtcggctgcgggacgat
gtgcagagcatcaactggctgcgggacggggtgcagctggcggaaagcaaccgcacccgc
atcacaggggaggaggtggaggtgcaggactccgtgcccgcagactccggcctctatgct
tgcgtaaccagcagcccctcgggcagtgacaccacctacttctccgtcaatgtttcagat
gctctcccctcctcggaggatgatgatgatgatgatgactcctcttcagaggagaaagaa
acagataacaccaaaccaaaccgtatgcccgtagctccatattggacatccccagaaaag
atggaaaagaaattgcatgcagtgccggctgccaagacagtgaagttcaaatgcccttcc
agtgggaccccaaaccccacactgcgctggttgaaaaatggcaaagaattcaaacctgac
cacagaattggaggctacaaggtccgttatgccacctggagcatcataatggactctgtg
gtgccctctgacaagggcaactacacctgcattgtggagaatgagtacggcagcatcaac
cacacataccagctggatgtcgtggagcggtcccctcaccggcccatcctgcaagcaggg
ttgcccgccaacaaaacagtggccctgggtagcaacgtggagttcatgtgtaaggtgtac
agtgacccgcagccgcacatccagtggctaaagcacatcgaggtgaatgggagcaagatt
ggcccagacaacctgccttatgtccagatcttgaagactgctggagttaataccaccgac
aaagagatggaggtgcttcacttaagaaatgtctcctttgaggacgcaggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagaggccggcagtgatgacctcgcccctgtacctggagatcatcatctat
tgcacaggggccttcctcatctcctgcatggtggggtcggtcatcgtctacaagatgaag
agtggtaccaagaagagtgacttccacagccagatggctgtgcacaagctggccaagagc
atccctctgcgcagacaggtgtctgctgactccagtgcatccatgaactctggggttctt
ctggttcggccatcacggctctcctccagtgggactcccatgctagcaggggtctctgag
tatgagcttcccgaagaccctcgctgggagctgcctcgggacagactggtcttaggcaaa
cccctgggagagggctgctttgggcaggtggtgttggcagaggctatcgggctggacaag
gacaaacccaaccgtgtgaccaaagtggctgtgaagatgttgaagtcggacgcaacagag
aaagacttgtcagacctgatctcagaaatggagatgatgaagatgatcgggaagcataag
aatatcatcaacctgctgggggcctgcacgcaggatggtcccttgtatgtcatcgtggag
tatgcctccaagggcaacctgcgggagtacctgcaggcccggaggcccccagggctggaa
tactgctacaaccccagccacaacccagaggagcagctctcctccaaggacctggtgtcc
tgcgcctaccaggtggcccgaggcatggagtatctggcctccaagaagtgcatacaccga
gacctggcagccaggaatgtcctggtgacagaggacaatgtgatgaagatagcagacttt
ggcctcgcacgggacattcaccacatcgactactataaaaagacaaccaacggccgactg
cctgtgaagtggatggcacccgaggcattatttgaccggatctacacccaccagagtgat
gtgtggtctttcggggtgctcctgtgggagatcttcactctgggcggctccccatacccc
ggtgtgcctgtggaggaacttttcaagctgctgaaggagggtcaccgcatggacaagccc
agtaactgcaccaacgagctgtacatgatgatgcgggactgctggcatgcagtgccctca
cagagacccaccttcaagcagctggtggaagacctggaccgcatcgtggccttgacctcc
aaccaggagtacctggacctgtccatgcccctggaccagtactcccccagctttcccgac
acccggagctctacgtgctcctcaggggaggattccgtcttctctcatgagccgctgccc
gaggagccctgcctgccccgacacccagcccagcttgccaatggcggactcaaacgccgc
tga

DBGET integrated database retrieval system