KEGG   Homo sapiens (human): 2260Help
Entry
2260              CDS       T01001                                 

Gene name
FGFR1, BFGFR, CD331, CEK, ECCL, FGFBR, FGFR-1, FLG, FLT-2, FLT2, HBGFR, HH2, HRTFDS, KAL2, N-SAM, OGD, bFGF-R-1
Definition
(RefSeq) fibroblast growth factor receptor 1
  KO
K04362  
fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Adherens junction
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Prostate cancer
Melanoma
Breast cancer
Central carbon metabolism in cancer
Disease
H00255  
Hypogonadotropic hypogonadism
H00443  
Osteoglophonic dysplasia (OD)
H00458  
Craniosynostosis
H00516  
Isolated orofacial clefts
H01207  
Trigonocephaly
Drug target
Brivanib (DG01373): 
Dovitinib lactate: 
Lenvatinib (DG01362): 
Nintedanib (DG01374): 
Regorafenib (DG00720): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2260 (FGFR1)
   04015 Rap1 signaling pathway
    2260 (FGFR1)
   04010 MAPK signaling pathway
    2260 (FGFR1)
   04151 PI3K-Akt signaling pathway
    2260 (FGFR1)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    2260 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    2260 (FGFR1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    2260 (FGFR1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2260 (FGFR1)
   05230 Central carbon metabolism in cancer
    2260 (FGFR1)
   05205 Proteoglycans in cancer
    2260 (FGFR1)
   05218 Melanoma
    2260 (FGFR1)
   05215 Prostate cancer
    2260 (FGFR1)
   05224 Breast cancer
    2260 (FGFR1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2260 (FGFR1)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  FGFR family [OT]
   2260 (FGFR1)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class IV (FGF receptor family)
   2260 (FGFR1)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class IV (FGF receptor family)
   2260 (FGFR1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   5/2 subfamily
    NCAM; neural cell adhesion molecule [KO:K06491]
     2260 (FGFR1)
   6/5 subfamily
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     2260 (FGFR1)
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type I classic cadherins
    CDH2; cadherin 2, type 1, N-cadherin [KO:K06736]
     2260 (FGFR1)
Cellular antigens [BR:hsa04090]
 Proteins
  2260 (FGFR1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2260 (FGFR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P11362(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
8p11.23
AA seq 822 aa AA seqDB search
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacactctgcacc
gctaggccgtccccgaccttgcctgaacaagcccagccctggggagcccctgtggaagtg
gagtccttcctggtccaccccggtgacctgctgcagcttcgctgtcggctgcgggacgat
gtgcagagcatcaactggctgcgggacggggtgcagctggcggaaagcaaccgcacccgc
atcacaggggaggaggtggaggtgcaggactccgtgcccgcagactccggcctctatgct
tgcgtaaccagcagcccctcgggcagtgacaccacctacttctccgtcaatgtttcagat
gctctcccctcctcggaggatgatgatgatgatgatgactcctcttcagaggagaaagaa
acagataacaccaaaccaaaccgtatgcccgtagctccatattggacatccccagaaaag
atggaaaagaaattgcatgcagtgccggctgccaagacagtgaagttcaaatgcccttcc
agtgggaccccaaaccccacactgcgctggttgaaaaatggcaaagaattcaaacctgac
cacagaattggaggctacaaggtccgttatgccacctggagcatcataatggactctgtg
gtgccctctgacaagggcaactacacctgcattgtggagaatgagtacggcagcatcaac
cacacataccagctggatgtcgtggagcggtcccctcaccggcccatcctgcaagcaggg
ttgcccgccaacaaaacagtggccctgggtagcaacgtggagttcatgtgtaaggtgtac
agtgacccgcagccgcacatccagtggctaaagcacatcgaggtgaatgggagcaagatt
ggcccagacaacctgccttatgtccagatcttgaagactgctggagttaataccaccgac
aaagagatggaggtgcttcacttaagaaatgtctcctttgaggacgcaggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagaggccggcagtgatgacctcgcccctgtacctggagatcatcatctat
tgcacaggggccttcctcatctcctgcatggtggggtcggtcatcgtctacaagatgaag
agtggtaccaagaagagtgacttccacagccagatggctgtgcacaagctggccaagagc
atccctctgcgcagacaggtaacagtgtctgctgactccagtgcatccatgaactctggg
gttcttctggttcggccatcacggctctcctccagtgggactcccatgctagcaggggtc
tctgagtatgagcttcccgaagaccctcgctgggagctgcctcgggacagactggtctta
ggcaaacccctgggagagggctgctttgggcaggtggtgttggcagaggctatcgggctg
gacaaggacaaacccaaccgtgtgaccaaagtggctgtgaagatgttgaagtcggacgca
acagagaaagacttgtcagacctgatctcagaaatggagatgatgaagatgatcgggaag
cataagaatatcatcaacctgctgggggcctgcacgcaggatggtcccttgtatgtcatc
gtggagtatgcctccaagggcaacctgcgggagtacctgcaggcccggaggcccccaggg
ctggaatactgctacaaccccagccacaacccagaggagcagctctcctccaaggacctg
gtgtcctgcgcctaccaggtggcccgaggcatggagtatctggcctccaagaagtgcata
caccgagacctggcagccaggaatgtcctggtgacagaggacaatgtgatgaagatagca
gactttggcctcgcacgggacattcaccacatcgactactataaaaagacaaccaacggc
cgactgcctgtgaagtggatggcacccgaggcattatttgaccggatctacacccaccag
agtgatgtgtggtctttcggggtgctcctgtgggagatcttcactctgggcggctcccca
taccccggtgtgcctgtggaggaacttttcaagctgctgaaggagggtcaccgcatggac
aagcccagtaactgcaccaacgagctgtacatgatgatgcgggactgctggcatgcagtg
ccctcacagagacccaccttcaagcagctggtggaagacctggaccgcatcgtggccttg
acctccaaccaggagtacctggacctgtccatgcccctggaccagtactcccccagcttt
cccgacacccggagctctacgtgctcctcaggggaggattccgtcttctctcatgagccg
ctgcccgaggagccctgcctgccccgacacccagcccagcttgccaatggcggactcaaa
cgccgctga

KEGG   Homo sapiens (human): 2261Help
Entry
2261              CDS       T01001                                 

Gene name
FGFR3, ACH, CD333, CEK2, HSFGFR3EX, JTK4
Definition
(RefSeq) fibroblast growth factor receptor 3
  KO
K05094  
fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Pathways in cancer
MicroRNAs in cancer
Bladder cancer
Central carbon metabolism in cancer
Disease
H00010  
Multiple myeloma
H00022  
Bladder cancer
H00458  
Craniosynostosis
H00505  
FGFR3-related short limb skeletal dysplasias
H00642  
Lacrimo-auriculo-dento-digital syndrome (LADD)
H00997  
CATSHL syndrome
Drug target
Dovitinib lactate: 
Lenvatinib (DG01362): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2261 (FGFR3)
   04015 Rap1 signaling pathway
    2261 (FGFR3)
   04010 MAPK signaling pathway
    2261 (FGFR3)
   04151 PI3K-Akt signaling pathway
    2261 (FGFR3)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2261 (FGFR3)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    2261 (FGFR3)
  Cell motility
   04810 Regulation of actin cytoskeleton
    2261 (FGFR3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2261 (FGFR3)
   05230 Central carbon metabolism in cancer
    2261 (FGFR3)
   05206 MicroRNAs in cancer
    2261 (FGFR3)
   05219 Bladder cancer
    2261 (FGFR3)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    2261 (FGFR3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2261 (FGFR3)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  FGFR family [OT]
   2261 (FGFR3)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class IV (FGF receptor family)
   2261 (FGFR3)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class IV (FGF receptor family)
   2261 (FGFR3)
Cellular antigens [BR:hsa04090]
 Proteins
  2261 (FGFR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P22607(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
4p16.3
AA seq 806 aa AA seqDB search
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE
EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE
GCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN
LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW
MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT
HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSS
SSSGDDSVFAHDLLPPAPPSSGGSRT
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcccctgcctgcgccctcgcgctctgcgtggccgtggccatcgtggccggcgcc
tcctcggagtccttggggacggagcagcgcgtcgtggggcgagcggcagaagtcccgggc
ccagagcccggccagcaggagcagttggtcttcggcagcggggatgctgtggagctgagc
tgtcccccgcccgggggtggtcccatggggcccactgtctgggtcaaggatggcacaggg
ctggtgccctcggagcgtgtcctggtggggccccagcggctgcaggtgctgaatgcctcc
cacgaggactccggggcctacagctgccggcagcggctcacgcagcgcgtactgtgccac
ttcagtgtgcgggtgacagacgctccatcctcgggagatgacgaagacggggaggacgag
gctgaggacacaggtgtggacacaggggccccttactggacacggcccgagcggatggac
aagaagctgctggccgtgccggccgccaacaccgtccgcttccgctgcccagccgctggc
aaccccactccctccatctcctggctgaagaacggcagggagttccgcggcgagcaccgc
attggaggcatcaagctgcggcatcagcagtggagcctggtcatggaaagcgtggtgccc
tcggaccgcggcaactacacctgcgtcgtggagaacaagtttggcagcatccggcagacg
tacacgctggacgtgctggagcgctccccgcaccggcccatcctgcaggcggggctgccg
gccaaccagacggcggtgctgggcagcgacgtggagttccactgcaaggtgtacagtgac
gcacagccccacatccagtggctcaagcacgtggaggtgaatggcagcaaggtgggcccg
gacggcacaccctacgttaccgtgctcaagacggcgggcgctaacaccaccgacaaggag
ctagaggttctctccttgcacaacgtcacctttgaggacgccggggagtacacctgcctg
gcgggcaattctattgggttttctcatcactctgcgtggctggtggtgctgccagccgag
gaggagctggtggaggctgacgaggcgggcagtgtgtatgcaggcatcctcagctacggg
gtgggcttcttcctgttcatcctggtggtggcggctgtgacgctctgccgcctgcgcagc
ccccccaagaaaggcctgggctcccccaccgtgcacaagatctcccgcttcccgctcaag
cgacaggtgtccctggagtccaacgcgtccatgagctccaacacaccactggtgcgcatc
gcaaggctgtcctcaggggagggccccacgctggccaatgtctccgagctcgagctgcct
gccgaccccaaatgggagctgtctcgggcccggctgaccctgggcaagccccttggggag
ggctgcttcggccaggtggtcatggcggaggccatcggcattgacaaggaccgggccgcc
aagcctgtcaccgtagccgtgaagatgctgaaagacgatgccactgacaaggacctgtcg
gacctggtgtctgagatggagatgatgaagatgatcgggaaacacaaaaacatcatcaac
ctgctgggcgcctgcacgcagggcgggcccctgtacgtgctggtggagtacgcggccaag
ggtaacctgcgggagtttctgcgggcgcggcggcccccgggcctggactactccttcgac
acctgcaagccgcccgaggagcagctcaccttcaaggacctggtgtcctgtgcctaccag
gtggcccggggcatggagtacttggcctcccagaagtgcatccacagggacctggctgcc
cgcaatgtgctggtgaccgaggacaacgtgatgaagatcgcagacttcgggctggcccgg
gacgtgcacaacctcgactactacaagaagacaaccaacggccggctgcccgtgaagtgg
atggcgcctgaggccttgtttgaccgagtctacactcaccagagtgacgtctggtccttt
ggggtcctgctctgggagatcttcacgctggggggctccccgtaccccggcatccctgtg
gaggagctcttcaagctgctgaaggagggccaccgcatggacaagcccgccaactgcaca
cacgacctgtacatgatcatgcgggagtgctggcatgccgcgccctcccagaggcccacc
ttcaagcagctggtggaggacctggaccgtgtccttaccgtgacgtccaccgacgagtac
ctggacctgtcggcgcctttcgagcagtactccccgggtggccaggacacccccagctcc
agctcctcaggggacgactccgtgtttgcccacgacctgctgcccccggccccacccagc
agtgggggctcgcggacgtga

KEGG   Homo sapiens (human): 2263Help
Entry
2263              CDS       T01001                                 

Gene name
FGFR2, BBDS, BEK, BFR-1, CD332, CEK3, CFD1, ECT1, JWS, K-SAM, KGFR, TK14, TK25
Definition
(RefSeq) fibroblast growth factor receptor 2
  KO
K05093  
fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Pathways in cancer
Prostate cancer
Central carbon metabolism in cancer
Disease
H00018  
Gastric cancer
H00458  
Craniosynostosis
H00642  
Lacrimo-auriculo-dento-digital syndrome (LADD)
Drug target
Brivanib (DG01373): 
Dovitinib lactate: 
Lenvatinib (DG01362): 
Nintedanib (DG01374): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2263 (FGFR2)
   04015 Rap1 signaling pathway
    2263 (FGFR2)
   04010 MAPK signaling pathway
    2263 (FGFR2)
   04151 PI3K-Akt signaling pathway
    2263 (FGFR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2263 (FGFR2)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    2263 (FGFR2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    2263 (FGFR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2263 (FGFR2)
   05230 Central carbon metabolism in cancer
    2263 (FGFR2)
   05215 Prostate cancer
    2263 (FGFR2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    2263 (FGFR2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2263 (FGFR2)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  FGFR family [OT]
   2263 (FGFR2)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class IV (FGF receptor family)
   2263 (FGFR2)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class IV (FGF receptor family)
   2263 (FGFR2)
Cellular antigens [BR:hsa04090]
 Proteins
  2263 (FGFR2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2263 (FGFR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P21802(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
10q26.13
AA seq 821 aa AA seqDB search
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEV
RCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYF
MVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP
AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSI
NHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSK
YGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL
PAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTK
RIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDK
LTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKM
IGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTF
KDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKT
TNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGH
RMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYS
PSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggtcagctggggtcgtttcatctgcctggtcgtggtcaccatggcaaccttgtccctg
gcccggccctccttcagtttagttgaggataccacattagagccagaagagccaccaacc
aaataccaaatctctcaaccagaagtgtacgtggctgcgccaggggagtcgctagaggtg
cgctgcctgttgaaagatgccgccgtgatcagttggactaaggatggggtgcacttgggg
cccaacaataggacagtgcttattggggagtacttgcagataaagggcgccacgcctaga
gactccggcctctatgcttgtactgccagtaggactgtagacagtgaaacttggtacttc
atggtgaatgtcacagatgccatctcatccggagatgatgaggatgacaccgatggtgcg
gaagattttgtcagtgagaacagtaacaacaagagagcaccatactggaccaacacagaa
aagatggaaaagcggctccatgctgtgcctgcggccaacactgtcaagtttcgctgccca
gccggggggaacccaatgccaaccatgcggtggctgaaaaacgggaaggagtttaagcag
gagcatcgcattggaggctacaaggtacgaaaccagcactggagcctcattatggaaagt
gtggtcccatctgacaagggaaattatacctgtgtagtggagaatgaatacgggtccatc
aatcacacgtaccacctggatgttgtggagcgatcgcctcaccggcccatcctccaagcc
ggactgccggcaaatgcctccacagtggtcggaggagacgtagagtttgtctgcaaggtt
tacagtgatgcccagccccacatccagtggatcaagcacgtggaaaagaacggcagtaaa
tacgggcccgacgggctgccctacctcaaggttctcaaggccgccggtgttaacaccacg
gacaaagagattgaggttctctatattcggaatgtaacttttgaggacgctggggaatat
acgtgcttggcgggtaattctattgggatatcctttcactctgcatggttgacagttctg
ccagcgcctggaagagaaaaggagattacagcttccccagactacctggagatagccatt
tactgcataggggtcttcttaatcgcctgtatggtggtaacagtcatcctgtgccgaatg
aagaacacgaccaagaagccagacttcagcagccagccggctgtgcacaagctgaccaaa
cgtatccccctgcggagacaggtaacagtttcggctgagtccagctcctccatgaactcc
aacaccccgctggtgaggataacaacacgcctctcttcaacggcagacacccccatgctg
gcaggggtctccgagtatgaacttccagaggacccaaaatgggagtttccaagagataag
ctgacactgggcaagcccctgggagaaggttgctttgggcaagtggtcatggcggaagca
gtgggaattgacaaagacaagcccaaggaggcggtcaccgtggccgtgaagatgttgaaa
gatgatgccacagagaaagacctttctgatctggtgtcagagatggagatgatgaagatg
attgggaaacacaagaatatcataaatcttcttggagcctgcacacaggatgggcctctc
tatgtcatagttgagtatgcctctaaaggcaacctccgagaatacctccgagcccggagg
ccacccgggatggagtactcctatgacattaaccgtgttcctgaggagcagatgaccttc
aaggacttggtgtcatgcacctaccagctggccagaggcatggagtacttggcttcccaa
aaatgtattcatcgagatttagcagccagaaatgttttggtaacagaaaacaatgtgatg
aaaatagcagactttggactcgccagagatatcaacaatatagactattacaaaaagacc
accaatgggcggcttccagtcaagtggatggctccagaagccctgtttgatagagtatac
actcatcagagtgatgtctggtccttcggggtgttaatgtgggagatcttcactttaggg
ggctcgccctacccagggattcccgtggaggaactttttaagctgctgaaggaaggacac
agaatggataagccagccaactgcaccaacgaactgtacatgatgatgagggactgttgg
catgcagtgccctcccagagaccaacgttcaagcagttggtagaagacttggatcgaatt
ctcactctcacaaccaatgaggaatacttggacctcagccaacctctcgaacagtattca
cctagttaccctgacacaagaagttcttgttcttcaggagatgattctgttttttctcca
gaccccatgccttacgaaccatgccttcctcagtatccacacataaacggcagtgttaaa
acatga

KEGG   Homo sapiens (human): 2264Help
Entry
2264              CDS       T01001                                 

Gene name
FGFR4, CD334, JTK2, TKF
Definition
(RefSeq) fibroblast growth factor receptor 4
  KO
K05095  
fibroblast growth factor receptor 4 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Drug target
Lenvatinib (DG01362): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2264 (FGFR4)
   04015 Rap1 signaling pathway
    2264 (FGFR4)
   04010 MAPK signaling pathway
    2264 (FGFR4)
   04151 PI3K-Akt signaling pathway
    2264 (FGFR4)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2264 (FGFR4)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    2264 (FGFR4)
  Cell motility
   04810 Regulation of actin cytoskeleton
    2264 (FGFR4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2264 (FGFR4)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  FGFR family [OT]
   2264 (FGFR4)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class IV (FGF receptor family)
   2264 (FGFR4)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class IV (FGF receptor family)
   2264 (FGFR4)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   5/2 subfamily
    NCAM; neural cell adhesion molecule [KO:K06491]
     2264 (FGFR4)
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type I classic cadherins
    CDH2; cadherin 2, type 1, N-cadherin [KO:K06736]
     2264 (FGFR4)
Cellular antigens [BR:hsa04090]
 Proteins
  2264 (FGFR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P22455(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
5q35.2
AA seq 802 aa AA seqDB search
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDS
LTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA
AAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC
TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM
QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA
LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG
LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS
VFSHDPLPLGSSSFPFGSGVQT
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgctgctggccctgttgggggtcctgctgagtgtgcctgggcctccagtcttg
tccctggaggcctctgaggaagtggagcttgagccctgcctggctcccagcctggagcag
caagagcaggagctgacagtagcccttgggcagcctgtgcgtctgtgctgtgggcgggct
gagcgtggtggccactggtacaaggagggcagtcgcctggcacctgctggccgtgtacgg
ggctggaggggccgcctagagattgccagcttcctacctgaggatgctggccgctacctc
tgcctggcacgaggctccatgatcgtcctgcagaatctcaccttgattacaggtgactcc
ttgacctccagcaacgatgatgaggaccccaagtcccatagggacccctcgaataggcac
agttacccccagcaagcaccctactggacacacccccagcgcatggagaagaaactgcat
gcagtacctgcggggaacaccgtcaagttccgctgtccagctgcaggcaaccccacgccc
accatccgctggcttaaggatggacaggcctttcatggggagaaccgcattggaggcatt
cggctgcgccatcagcactggagtctcgtgatggagagcgtggtgccctcggaccgcggc
acatacacctgcctggtagagaacgctgtgggcagcatccgctataactacctgctagat
gtgctggagcggtccccgcaccggcccatcctgcaggccgggctcccggccaacaccaca
gccgtggtgggcagcgacgtggagctgctgtgcaaggtgtacagcgatgcccagccccac
atccagtggctgaagcacatcgtcatcaacggcagcagcttcggagccgacggtttcccc
tatgtgcaagtcctaaagactgcagacatcaatagctcagaggtggaggtcctgtacctg
cggaacgtgtcagccgaggacgcaggcgagtacacctgcctcgcaggcaattccatcggc
ctctcctaccagtctgcctggctcacggtgctgccagaggaggaccccacatggaccgca
gcagcgcccgaggccaggtatacggacatcatcctgtacgcgtcgggctccctggccttg
gctgtgctcctgctgctggccgggctgtatcgagggcaggcgctccacggccggcacccc
cgcccgcccgccactgtgcagaagctctcccgcttccctctggcccgacagttctccctg
gagtcaggctcttccggcaagtcaagctcatccctggtacgaggcgtgcgtctctcctcc
agcggccccgccttgctcgccggcctcgtgagtctagatctacctctcgacccactatgg
gagttcccccgggacaggctggtgcttgggaagcccctaggcgagggctgctttggccag
gtagtacgtgcagaggcctttggcatggaccctgcccggcctgaccaagccagcactgtg
gccgtcaagatgctcaaagacaacgcctctgacaaggacctggccgacctggtctcggag
atggaggtgatgaagctgatcggccgacacaagaacatcatcaacctgcttggtgtctgc
acccaggaagggcccctgtacgtgatcgtggagtgcgccgccaagggaaacctgcgggag
ttcctgcgggcccggcgccccccaggccccgacctcagccccgacggtcctcggagcagt
gaggggccgctctccttcccagtcctggtctcctgcgcctaccaggtggcccgaggcatg
cagtatctggagtcccggaagtgtatccaccgggacctggctgcccgcaatgtgctggtg
actgaggacaatgtgatgaagattgctgactttgggctggcccgcggcgtccaccacatt
gactactataagaaaaccagcaacggccgcctgcctgtgaagtggatggcgcccgaggcc
ttgtttgaccgggtgtacacacaccagagtgacgtgtggtcttttgggatcctgctatgg
gagatcttcaccctcgggggctccccgtatcctggcatcccggtggaggagctgttctcg
ctgctgcgggagggacatcggatggaccgacccccacactgccccccagagctgtacggg
ctgatgcgtgagtgctggcacgcagcgccctcccagaggcctaccttcaagcagctggtg
gaggcgctggacaaggtcctgctggccgtctctgaggagtacctcgacctccgcctgacc
ttcggaccctattccccctctggtggggacgccagcagcacctgctcctccagcgattct
gtcttcagccacgaccccctgccattgggatccagctccttccccttcgggtctggggtg
cagacatga

DBGET integrated database retrieval system