KEGG   Homo sapiens (human): 2261Help
Entry
2261              CDS       T01001                                 

Gene name
FGFR3, ACH, CD333, CEK2, HSFGFR3EX, JTK4
Definition
fibroblast growth factor receptor 3 (EC:2.7.10.1)
Orthology
K05094  
fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Pathways in cancer
MicroRNAs in cancer
Bladder cancer
Central carbon metabolism in cancer
Disease
H00010  
Multiple myeloma
H00022  
Bladder cancer
H00458  
Craniosynostosis
H00505  
FGFR3-related short limb skeletal dysplasias
H00642  
Lacrimo-auriculo-dento-digital syndrome (LADD)
H00997  
CATSHL syndrome
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2261 (FGFR3)
   04015 Rap1 signaling pathway
    2261 (FGFR3)
   04010 MAPK signaling pathway
    2261 (FGFR3)
   04151 PI3K-Akt signaling pathway
    2261 (FGFR3)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2261 (FGFR3)
  Cell motility
   04810 Regulation of actin cytoskeleton
    2261 (FGFR3)
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    2261 (FGFR3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2261 (FGFR3)
   05230 Central carbon metabolism in cancer
    2261 (FGFR3)
   05206 MicroRNAs in cancer
    2261 (FGFR3)
   05219 Bladder cancer
    2261 (FGFR3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2261 (FGFR3)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  FGFR family [OT]
   2261 (FGFR3)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class IV (FGF receptor family)
   2261 (FGFR3)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class IV (FGF receptor family)
   2261 (FGFR3)
Cellular antigens [BR:hsa04090]
 Proteins
  2261 (FGFR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p16.3
AA seq 806 aa AA seqDB search
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE
EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE
GCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN
LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW
MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT
HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSS
SSSGDDSVFAHDLLPPAPPSSGGSRT
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcccctgcctgcgccctcgcgctctgcgtggccgtggccatcgtggccggcgcc
tcctcggagtccttggggacggagcagcgcgtcgtggggcgagcggcagaagtcccgggc
ccagagcccggccagcaggagcagttggtcttcggcagcggggatgctgtggagctgagc
tgtcccccgcccgggggtggtcccatggggcccactgtctgggtcaaggatggcacaggg
ctggtgccctcggagcgtgtcctggtggggccccagcggctgcaggtgctgaatgcctcc
cacgaggactccggggcctacagctgccggcagcggctcacgcagcgcgtactgtgccac
ttcagtgtgcgggtgacagacgctccatcctcgggagatgacgaagacggggaggacgag
gctgaggacacaggtgtggacacaggggccccttactggacacggcccgagcggatggac
aagaagctgctggccgtgccggccgccaacaccgtccgcttccgctgcccagccgctggc
aaccccactccctccatctcctggctgaagaacggcagggagttccgcggcgagcaccgc
attggaggcatcaagctgcggcatcagcagtggagcctggtcatggaaagcgtggtgccc
tcggaccgcggcaactacacctgcgtcgtggagaacaagtttggcagcatccggcagacg
tacacgctggacgtgctggagcgctccccgcaccggcccatcctgcaggcggggctgccg
gccaaccagacggcggtgctgggcagcgacgtggagttccactgcaaggtgtacagtgac
gcacagccccacatccagtggctcaagcacgtggaggtgaatggcagcaaggtgggcccg
gacggcacaccctacgttaccgtgctcaagacggcgggcgctaacaccaccgacaaggag
ctagaggttctctccttgcacaacgtcacctttgaggacgccggggagtacacctgcctg
gcgggcaattctattgggttttctcatcactctgcgtggctggtggtgctgccagccgag
gaggagctggtggaggctgacgaggcgggcagtgtgtatgcaggcatcctcagctacggg
gtgggcttcttcctgttcatcctggtggtggcggctgtgacgctctgccgcctgcgcagc
ccccccaagaaaggcctgggctcccccaccgtgcacaagatctcccgcttcccgctcaag
cgacaggtgtccctggagtccaacgcgtccatgagctccaacacaccactggtgcgcatc
gcaaggctgtcctcaggggagggccccacgctggccaatgtctccgagctcgagctgcct
gccgaccccaaatgggagctgtctcgggcccggctgaccctgggcaagccccttggggag
ggctgcttcggccaggtggtcatggcggaggccatcggcattgacaaggaccgggccgcc
aagcctgtcaccgtagccgtgaagatgctgaaagacgatgccactgacaaggacctgtcg
gacctggtgtctgagatggagatgatgaagatgatcgggaaacacaaaaacatcatcaac
ctgctgggcgcctgcacgcagggcgggcccctgtacgtgctggtggagtacgcggccaag
ggtaacctgcgggagtttctgcgggcgcggcggcccccgggcctggactactccttcgac
acctgcaagccgcccgaggagcagctcaccttcaaggacctggtgtcctgtgcctaccag
gtggcccggggcatggagtacttggcctcccagaagtgcatccacagggacctggctgcc
cgcaatgtgctggtgaccgaggacaacgtgatgaagatcgcagacttcgggctggcccgg
gacgtgcacaacctcgactactacaagaagacaaccaacggccggctgcccgtgaagtgg
atggcgcctgaggccttgtttgaccgagtctacactcaccagagtgacgtctggtccttt
ggggtcctgctctgggagatcttcacgctggggggctccccgtaccccggcatccctgtg
gaggagctcttcaagctgctgaaggagggccaccgcatggacaagcccgccaactgcaca
cacgacctgtacatgatcatgcgggagtgctggcatgccgcgccctcccagaggcccacc
ttcaagcagctggtggaggacctggaccgtgtccttaccgtgacgtccaccgacgagtac
ctggacctgtcggcgcctttcgagcagtactccccgggtggccaggacacccccagctcc
agctcctcaggggacgactccgtgtttgcccacgacctgctgcccccggccccacccagc
agtgggggctcgcggacgtga

DBGET integrated database retrieval system