KEGG   Homo sapiens (human): 2261Help
Entry
2261              CDS       T01001                                 

Gene name
FGFR3, ACH, CD333, CEK2, HSFGFR3EX, JTK4
Definition
fibroblast growth factor receptor 3 (EC:2.7.10.1)
Orthology
K05094  
fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
MicroRNAs in cancer
Bladder cancer
Disease
H00010  
Multiple myeloma
H00022  
Bladder cancer
H00458  
Craniosynostosis
H00505  
FGFR3-related short limb skeletal dysplasias
H00642  
Lacrimo-auriculo-dento-digital syndrome (LADD)
H00997  
CATSHL syndrome
Drug target
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Bladder cancer [PATH:hsa05219]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p16.3
AA seq 806 aa AA seqDB search
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE
EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE
GCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN
LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW
MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT
HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSS
SSSGDDSVFAHDLLPPAPPSSGGSRT
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcccctgcctgcgccctcgcgctctgcgtggccgtggccatcgtggccggcgcc
tcctcggagtccttggggacggagcagcgcgtcgtggggcgagcggcagaagtcccgggc
ccagagcccggccagcaggagcagttggtcttcggcagcggggatgctgtggagctgagc
tgtcccccgcccgggggtggtcccatggggcccactgtctgggtcaaggatggcacaggg
ctggtgccctcggagcgtgtcctggtggggccccagcggctgcaggtgctgaatgcctcc
cacgaggactccggggcctacagctgccggcagcggctcacgcagcgcgtactgtgccac
ttcagtgtgcgggtgacagacgctccatcctcgggagatgacgaagacggggaggacgag
gctgaggacacaggtgtggacacaggggccccttactggacacggcccgagcggatggac
aagaagctgctggccgtgccggccgccaacaccgtccgcttccgctgcccagccgctggc
aaccccactccctccatctcctggctgaagaacggcagggagttccgcggcgagcaccgc
attggaggcatcaagctgcggcatcagcagtggagcctggtcatggaaagcgtggtgccc
tcggaccgcggcaactacacctgcgtcgtggagaacaagtttggcagcatccggcagacg
tacacgctggacgtgctggagcgctccccgcaccggcccatcctgcaggcggggctgccg
gccaaccagacggcggtgctgggcagcgacgtggagttccactgcaaggtgtacagtgac
gcacagccccacatccagtggctcaagcacgtggaggtgaatggcagcaaggtgggcccg
gacggcacaccctacgttaccgtgctcaagacggcgggcgctaacaccaccgacaaggag
ctagaggttctctccttgcacaacgtcacctttgaggacgccggggagtacacctgcctg
gcgggcaattctattgggttttctcatcactctgcgtggctggtggtgctgccagccgag
gaggagctggtggaggctgacgaggcgggcagtgtgtatgcaggcatcctcagctacggg
gtgggcttcttcctgttcatcctggtggtggcggctgtgacgctctgccgcctgcgcagc
ccccccaagaaaggcctgggctcccccaccgtgcacaagatctcccgcttcccgctcaag
cgacaggtgtccctggagtccaacgcgtccatgagctccaacacaccactggtgcgcatc
gcaaggctgtcctcaggggagggccccacgctggccaatgtctccgagctcgagctgcct
gccgaccccaaatgggagctgtctcgggcccggctgaccctgggcaagccccttggggag
ggctgcttcggccaggtggtcatggcggaggccatcggcattgacaaggaccgggccgcc
aagcctgtcaccgtagccgtgaagatgctgaaagacgatgccactgacaaggacctgtcg
gacctggtgtctgagatggagatgatgaagatgatcgggaaacacaaaaacatcatcaac
ctgctgggcgcctgcacgcagggcgggcccctgtacgtgctggtggagtacgcggccaag
ggtaacctgcgggagtttctgcgggcgcggcggcccccgggcctggactactccttcgac
acctgcaagccgcccgaggagcagctcaccttcaaggacctggtgtcctgtgcctaccag
gtggcccggggcatggagtacttggcctcccagaagtgcatccacagggacctggctgcc
cgcaatgtgctggtgaccgaggacaacgtgatgaagatcgcagacttcgggctggcccgg
gacgtgcacaacctcgactactacaagaagacaaccaacggccggctgcccgtgaagtgg
atggcgcctgaggccttgtttgaccgagtctacactcaccagagtgacgtctggtccttt
ggggtcctgctctgggagatcttcacgctggggggctccccgtaccccggcatccctgtg
gaggagctcttcaagctgctgaaggagggccaccgcatggacaagcccgccaactgcaca
cacgacctgtacatgatcatgcgggagtgctggcatgccgcgccctcccagaggcccacc
ttcaagcagctggtggaggacctggaccgtgtccttaccgtgacgtccaccgacgagtac
ctggacctgtcggcgcctttcgagcagtactccccgggtggccaggacacccccagctcc
agctcctcaggggacgactccgtgtttgcccacgacctgctgcccccggccccacccagc
agtgggggctcgcggacgtga

DBGET integrated database retrieval system