KEGG   Homo sapiens (human): 2264Help
Entry
2264              CDS       T01001                                 

Gene name
FGFR4, CD334, JTK2, TKF
Definition
fibroblast growth factor receptor 4 (EC:2.7.10.1)
Orthology
K05095  
fibroblast growth factor receptor 4 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2264 (FGFR4)
   04015 Rap1 signaling pathway
    2264 (FGFR4)
   04010 MAPK signaling pathway
    2264 (FGFR4)
   04151 PI3K-Akt signaling pathway
    2264 (FGFR4)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2264 (FGFR4)
  Cell motility
   04810 Regulation of actin cytoskeleton
    2264 (FGFR4)
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    2264 (FGFR4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2264 (FGFR4)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  FGFR family [OT]
   2264 (FGFR4)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class IV (FGF receptor family)
   2264 (FGFR4)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class IV (FGF receptor family)
   2264 (FGFR4)
Cellular antigens [BR:hsa04090]
 Proteins
  2264 (FGFR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.2
AA seq 734 aa AA seqDB search
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDS
LTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA
AAPEASSPWSQALPASQAHPWYEACVSPPAAPPCSPASLVLGKPLGEGCFGQVVRAEAFG
MDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYV
IVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQYLESRKC
IHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTH
QSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHA
APSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLP
LGSSSFPFGSGVQT
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgctgctggccctgttgggggtcctgctgagtgtgcctgggcctccagtcttg
tccctggaggcctctgaggaagtggagcttgagccctgcctggctcccagcctggagcag
caagagcaggagctgacagtagcccttgggcagcctgtgcgtctgtgctgtgggcgggct
gagcgtggtggccactggtacaaggagggcagtcgcctggcacctgctggccgtgtacgg
ggctggaggggccgcctagagattgccagcttcctacctgaggatgctggccgctacctc
tgcctggcacgaggctccatgatcgtcctgcagaatctcaccttgattacaggtgactcc
ttgacctccagcaacgatgatgaggaccccaagtcccatagggacccctcgaataggcac
agttacccccagcaagcaccctactggacacacccccagcgcatggagaagaaactgcat
gcagtacctgcggggaacaccgtcaagttccgctgtccagctgcaggcaaccccacgccc
accatccgctggcttaaggatggacaggcctttcatggggagaaccgcattggaggcatt
cggctgcgccatcagcactggagtctcgtgatggagagcgtggtgccctcggaccgcggc
acatacacctgcctggtagagaacgctgtgggcagcatccgctataactacctgctagat
gtgctggagcggtccccgcaccggcccatcctgcaggccgggctcccggccaacaccaca
gccgtggtgggcagcgacgtggagctgctgtgcaaggtgtacagcgatgcccagccccac
atccagtggctgaagcacatcgtcatcaacggcagcagcttcggagccgacggtttcccc
tatgtgcaagtcctaaagactgcagacatcaatagctcagaggtggaggtcctgtacctg
cggaacgtgtcagccgaggacgcaggcgagtacacctgcctcgcaggcaattccatcggc
ctctcctaccagtctgcctggctcacggtgctgccagaggaggaccccacatggaccgca
gcagcgcccgaggccagttctccctggagtcaggctcttccggcaagtcaagctcatccc
tggtacgaggcgtgcgtctctcctccagcggccccgccttgctcgccggcctcgctggtg
cttgggaagcccctaggcgagggctgctttggccaggtagtacgtgcagaggcctttggc
atggaccctgcccggcctgaccaagccagcactgtggccgtcaagatgctcaaagacaac
gcctctgacaaggacctggccgacctggtctcggagatggaggtgatgaagctgatcggc
cgacacaagaacatcatcaacctgcttggtgtctgcacccaggaagggcccctgtacgtg
atcgtggagtgcgccgccaagggaaacctgcgggagttcctgcgggcccggcgcccccca
ggccccgacctcagccccgacggtcctcggagcagtgaggggccgctctccttcccagtc
ctggtctcctgcgcctaccaggtggcccgaggcatgcagtatctggagtcccggaagtgt
atccaccgggacctggctgcccgcaatgtgctggtgactgaggacaatgtgatgaagatt
gctgactttgggctggcccgcggcgtccaccacattgactactataagaaaaccagcaac
ggccgcctgcctgtgaagtggatggcgcccgaggccttgtttgaccgggtgtacacacac
cagagtgacgtgtggtcttttgggatcctgctatgggagatcttcaccctcgggggctcc
ccgtatcctggcatcccggtggaggagctgttctcgctgctgcgggagggacatcggatg
gaccgacccccacactgccccccagagctgtacgggctgatgcgtgagtgctggcacgca
gcgccctcccagaggcctaccttcaagcagctggtggaggcgctggacaaggtcctgctg
gccgtctctgaggagtacctcgacctccgcctgaccttcggaccctattccccctctggt
ggggacgccagcagcacctgctcctccagcgattctgtcttcagccacgaccccctgcca
ttgggatccagctccttccccttcgggtctggggtgcagacatga

DBGET integrated database retrieval system