KEGG   Homo sapiens (human): 2268Help
Entry
2268              CDS       T01001                                 

Gene name
FGR, SRC2, c-fgr, c-src2, p55-Fgr, p55c-fgr, p58-Fgr, p58c-fgr
Definition
feline Gardner-Rasheed sarcoma viral oncogene homolog (EC:2.7.10.2)
Orthology
K08891  
tyrosine-protein kinase Fgr [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Epstein-Barr virus infection
Class
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.2-p36.1
AA seq 529 aa AA seqDB search
MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQA
INPGFLDSGTIRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSL
SSGKTGCIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAY
SLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHYMEVNDGLCNLLIAP
CTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSP
KAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPEGQDLRLPQLV
DMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKF
PIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCP
PGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtgttctgcaagaaattggagccggtggccacggccaaggaggatgctggc
ctggaaggggacttcagaagctacggggcagcagaccactatgggcctgaccccactaag
gcccggcctgcatcctcatttgcccacatccccaactacagcaacttctcctctcaggcc
atcaaccctggcttccttgatagtggcaccatcaggggtgtgtcagggattggggtgacc
ctgttcattgccctgtatgactatgaggctcgaactgaggatgacctcaccttcaccaag
ggcgagaagttccacatcctgaacaatactgaaggtgactggtgggaggctcggtctctc
agctccggaaaaactggctgcattcccagcaactacgtggcccctgttgactcaatccaa
gctgaagagtggtactttggaaagattgggagaaaggatgcagagaggcagctgctttca
ccaggcaacccccagggggcctttctcattcgggaaagcgagaccaccaaaggtgcctac
tccctgtccatccgggactgggatcagaccagaggcgatcatgtgaagcattacaagatc
cgcaaactggacatgggcggctactacatcaccacacgggttcagttcaactcggtgcag
gagctggtgcagcactacatggaggtgaatgacgggctgtgcaacctgctcatcgcgccc
tgcaccatcatgaagccgcagacgctgggcctggccaaggacgcctgggagatcagccgc
agctccatcacgctggagcgccggctgggcaccggctgcttcggggatgtgtggctgggc
acgtggaacggcagcactaaggtggcggtgaagacgctgaagccgggcaccatgtccccg
aaggccttcctggaggaggcgcaggtcatgaagctgctgcggcacgacaagctggtgcag
ctgtacgccgtggtgtcggaggagcccatctacatcgtgaccgagttcatgtgtcacggc
agcttgctggattttctcaagaacccagagggccaggatttgaggctgccccaattggtg
gacatggcagcccaggtagctgagggcatggcctacatggaacgcatgaactacattcac
cgcgacctgagggcagccaacatcctggttggggagcggctggcgtgcaagatcgcagac
tttggcttggcgcgtctcatcaaggacgatgagtacaacccctgccaaggttccaagttc
cccatcaagtggacagccccagaagctgccctctttggcagattcaccatcaagtcagac
gtgtggtcctttgggatcctgctcactgagctcatcaccaagggccgaatcccctaccca
ggcatgaataaacgggaagtgttggaacaggtggagcagggctaccacatgccgtgccct
ccaggctgcccagcatccctgtacgaggccatggaacagacctggcgtctggacccggag
gagaggcctaccttcgagtacctgcagtccttcctggaggactacttcacctccgctgaa
ccacagtaccagcccggggatcagacatag

DBGET integrated database retrieval system