KEGG   Homo sapiens (human): 2271Help
Entry
2271              CDS       T01001                                 

Gene name
FH, HLRCC, LRCC, MCL, MCUL1
Definition
fumarate hydratase (EC:4.2.1.2)
Orthology
K01679  
fumarate hydratase, class II [EC:4.2.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Pathways in cancer
Renal cell carcinoma
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Disease
H00021  
Renal cell carcinoma
H00804  
Multiple cutaneous and uterine leiomyomata
H01022  
Diseases of the tricarboxylic acid cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    2271 (FH)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    2271 (FH)
   00620 Pyruvate metabolism
    2271 (FH)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2271 (FH)
   05211 Renal cell carcinoma
    2271 (FH)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     2271 (FH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q42.1
AA seq 510 aa AA seqDB search
MYRALRLLARSRPLVRAPAAALASAPGLGGAAVPSFWPPNAARMASQNSFRIEYDTFGEL
KVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAI
MKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDH
VNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAV
PLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAAL
TGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPE
NEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSA
RLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGS
TLKETAIELGYLTAEQFDEWVKPKDMLGPK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgagcacttcggctcctcgcgcgctcgcgtcccctcgtgcgggctccagccgca
gccttagcttcggctcccggcttgggtggcgcggccgtgccctcgttttggcctccgaac
gcggctcgaatggcaagccaaaattccttccggatagaatatgatacctttggtgaacta
aaggtgccaaatgataagtattatggcgcccagaccgtgagatctacgatgaactttaag
attggaggtgtgacagaacgcatgccaaccccagttattaaagcttttggcatcttgaag
cgagcggccgctgaagtaaaccaggattatggtcttgatccaaagattgctaatgcaata
atgaaggcagcagatgaggtagctgaaggtaaattaaatgatcattttcctctcgtggta
tggcagactggatcaggaactcagacaaatatgaatgtaaatgaagtcattagcaataga
gcaattgaaatgttaggaggtgaacttggcagcaagatacctgtgcatcccaacgatcat
gttaataaaagccagagctcaaatgatacttttcccacagcaatgcacattgctgctgca
atagaagttcatgaagtactgttaccaggactacagaagttacatgatgctcttgatgca
aaatccaaagagtttgcacagatcatcaagattggacgtactcatactcaggatgctgtt
ccacttactcttgggcaggaatttagtggttatgttcaacaagtaaaatatgcaatgaca
agaataaaagctgccatgccaagaatctatgagctcgcagctggaggcactgctgttggt
acaggtttaaatactagaattggctttgcagaaaaggttgctgcaaaagtggctgcactt
acaggcttgccttttgtcactgctccgaataaatttgaagctctggctgctcatgacgct
ctggttgagctcagtggagccatgaacactactgcctgcagtctgatgaagatagcaaat
gatattcgatttttgggttctggtcctcggtcaggtctgggagaattgatcttgcctgaa
aatgaaccaggaagcagtatcatgccaggcaaggtgaaccctactcagtgtgaagcaatg
accatggttgcagcccaagtcatggggaaccatgttgctgtcactgtcggaggcagcaat
ggacattttgagttgaatgttttcaagccaatgatgattaaaaatgtgttacactcagcc
aggctgctgggggatgcttcagtttcctttacagaaaactgcgtggtgggaatccaggcc
aatacagaaaggatcaacaagctgatgaatgagtctctaatgttggtgacagctctcaat
cctcatatagggtatgacaaggcagcaaagattgctaagacagcacacaaaaatggatca
accttaaaggaaactgctatcgaacttggctatctcacagcagagcagtttgacgaatgg
gtaaaacctaaggacatgctgggtccaaagtga

DBGET integrated database retrieval system