KEGG   Homo sapiens (human): 2272Help
Entry
2272              CDS       T01001                                 

Gene name
FHIT, AP3Aase, FRA3B
Definition
fragile histidine triad (EC:3.6.1.29)
Orthology
K01522  
bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Small cell lung cancer
Non-small cell lung cancer
Disease
H00013  
Small cell lung cancer
H00014  
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    2272 (FHIT)
 Human Diseases
  Cancers
   05222 Small cell lung cancer
    2272 (FHIT)
   05223 Non-small cell lung cancer
    2272 (FHIT)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     2272 (FHIT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p14.2
AA seq 147 aa AA seqDB search
MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ
TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH
DKEDFPASWRSEEEMAAEAAALRVYFQ
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcagatttggccaacatctcatcaagccctctgtagtgtttctcaaaacagaa
ctgtccttcgctcttgtgaataggaaacctgtggtaccaggacatgtccttgtgtgcccg
ctgcggccagtggagcgcttccatgacctgcgtcctgatgaagtggccgatttgtttcag
acgacccagagagtcgggacagtggtggaaaaacatttccatgggacctctctcaccttt
tccatgcaggatggccccgaagccggacagactgtgaagcacgttcacgtccatgttctt
cccaggaaggctggagactttcacaggaatgacagcatctatgaggagctccagaaacat
gacaaggaggactttcctgcctcttggagatcagaggaggaaatggcagcagaagccgca
gctctgcgggtctactttcagtga

DBGET integrated database retrieval system