KEGG   Homo sapiens (human): 2277Help
Entry
2277              CDS       T01001                                 

Gene name
VEGFD, FIGF, VEGF-D
Definition
(RefSeq) vascular endothelial growth factor D
  KO
K05449  
vascular endothelial growth factor C/D
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Focal adhesion
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer
Disease
H00018  
Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2277 (VEGFD)
   04015 Rap1 signaling pathway
    2277 (VEGFD)
   04151 PI3K-Akt signaling pathway
    2277 (VEGFD)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2277 (VEGFD)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    2277 (VEGFD)
 Organismal Systems
  Endocrine system
   04926 Relaxin signaling pathway
    2277 (VEGFD)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2277 (VEGFD)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    2277 (VEGFD)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    2277 (VEGFD)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-9
    ITGB1; integrin beta 1 [KO:K05719]
     2277 (VEGFD)
 7. Others
  NRP1; neuropilin 1 [KO:K06724]
   2277 (VEGFD)
  NRP2; neuropilin 2 [KO:K06819]
   2277 (VEGFD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O43915(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.2
AA seq 354 aa AA seqDB search
MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSE
DWKLWRCRLRLKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEV
ASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVP
VKVANHTGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEE
NPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETC
CQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHSRKNP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtacagagagtgggtagtggtgaatgttttcatgatgttgtacgtccagctggtgcag
ggctccagtaatgaacatggaccagtgaagcgatcatctcagtccacattggaacgatct
gaacagcagatcagggctgcttctagtttggaggaactacttcgaattactcactctgag
gactggaagctgtggagatgcaggctgaggctcaaaagttttaccagtatggactctcgc
tcagcatcccatcggtccactaggtttgcggcaactttctatgacattgaaacactaaaa
gttatagatgaagaatggcaaagaactcagtgcagccctagagaaacgtgcgtggaggtg
gccagtgagctggggaagagtaccaacacattcttcaagcccccttgtgtgaacgtgttc
cgatgtggtggctgttgcaatgaagagagccttatctgtatgaacaccagcacctcgtac
atttccaaacagctctttgagatatcagtgcctttgacatcagtacctgaattagtgcct
gttaaagttgccaatcatacaggttgtaagtgcttgccaacagccccccgccatccatac
tcaattatcagaagatccatccagatccctgaagaagatcgctgttcccattccaagaaa
ctctgtcctattgacatgctatgggatagcaacaaatgtaaatgtgttttgcaggaggaa
aatccacttgctggaacagaagaccactctcatctccaggaaccagctctctgtgggcca
cacatgatgtttgacgaagatcgttgcgagtgtgtctgtaaaacaccatgtcccaaagat
ctaatccagcaccccaaaaactgcagttgctttgagtgcaaagaaagtctggagacctgc
tgccagaagcacaagctatttcacccagacacctgcagctgtgaggacagatgccccttt
cataccagaccatgtgcaagtggcaaaacagcatgtgcaaagcattgccgctttccaaag
gagaaaagggctgcccaggggccccacagccgaaagaatccttga

DBGET integrated database retrieval system