KEGG   Homo sapiens (human): 2277Help
Entry
2277              CDS       T01001                                 

Gene name
VEGFD, FIGF, VEGF-D
Definition
(RefSeq) vascular endothelial growth factor D
  KO
K05449  vascular endothelial growth factor C/D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2277 (VEGFD)
   04015 Rap1 signaling pathway
    2277 (VEGFD)
   04010 MAPK signaling pathway
    2277 (VEGFD)
   04151 PI3K-Akt signaling pathway
    2277 (VEGFD)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2277 (VEGFD)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    2277 (VEGFD)
 Organismal Systems
  Endocrine system
   04926 Relaxin signaling pathway
    2277 (VEGFD)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2277 (VEGFD)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    2277 (VEGFD)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2277 (VEGFD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF CXCXC
Motif
Other DBs
NCBI-GeneID: 2277
NCBI-ProteinID: NP_004460
OMIM: 300091
HGNC: 3708
Ensembl: ENSG00000165197
Vega: OTTHUMG00000021175
Pharos: O43915(Tbio)
UniProt: O43915
Structure
PDB: 

Jmol
Position
Xp22.2
AA seq 354 aa AA seqDB search
MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSE
DWKLWRCRLRLKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEV
ASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVP
VKVANHTGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEE
NPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETC
CQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHSRKNP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtacagagagtgggtagtggtgaatgttttcatgatgttgtacgtccagctggtgcag
ggctccagtaatgaacatggaccagtgaagcgatcatctcagtccacattggaacgatct
gaacagcagatcagggctgcttctagtttggaggaactacttcgaattactcactctgag
gactggaagctgtggagatgcaggctgaggctcaaaagttttaccagtatggactctcgc
tcagcatcccatcggtccactaggtttgcggcaactttctatgacattgaaacactaaaa
gttatagatgaagaatggcaaagaactcagtgcagccctagagaaacgtgcgtggaggtg
gccagtgagctggggaagagtaccaacacattcttcaagcccccttgtgtgaacgtgttc
cgatgtggtggctgttgcaatgaagagagccttatctgtatgaacaccagcacctcgtac
atttccaaacagctctttgagatatcagtgcctttgacatcagtacctgaattagtgcct
gttaaagttgccaatcatacaggttgtaagtgcttgccaacagccccccgccatccatac
tcaattatcagaagatccatccagatccctgaagaagatcgctgttcccattccaagaaa
ctctgtcctattgacatgctatgggatagcaacaaatgtaaatgtgttttgcaggaggaa
aatccacttgctggaacagaagaccactctcatctccaggaaccagctctctgtgggcca
cacatgatgtttgacgaagatcgttgcgagtgtgtctgtaaaacaccatgtcccaaagat
ctaatccagcaccccaaaaactgcagttgctttgagtgcaaagaaagtctggagacctgc
tgccagaagcacaagctatttcacccagacacctgcagctgtgaggacagatgccccttt
cataccagaccatgtgcaagtggcaaaacagcatgtgcaaagcattgccgctttccaaag
gagaaaagggctgcccaggggccccacagccgaaagaatccttga

DBGET integrated database retrieval system