KEGG   Homo sapiens (human): 22794Help
Entry
22794             CDS       T01001                                 

Gene name
CASC3, BTZ, MLN51
Definition
(RefSeq) cancer susceptibility candidate 3
  KO
K14323  
protein CASC3
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Module
Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    22794 (CASC3)
   03015 mRNA surveillance pathway
    22794 (CASC3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     22794 (CASC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.1
AA seq 703 aa AA seqDB search
MADRRRQRASQDTEDEESGASGSDSGGSPLRGGGSCSGSAGGGGSGSLPSQRGGRTGALH
LRRVESGGAKSAEESECESEDGIEGDAVLSDYESAEDSEGEEGEYSEEENSKVELKSEAN
DAVNSSTKEEKGEEKPDTKSTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPA
YIPRKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALY
GYDIRSAHNPDDIKPRRIRKPRYGSPPQRDPNWNGERLNKSHRHQGLGGTLPPRTFINRN
AAGTGRMSAPRNYSRSGGFKEGRAGFRPVEAGGQHGGRSGETVKHEISYRSRRLEQTSVR
DPSPEADAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKL
AEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLNIAEQNWSPGQ
PSFLQPRELRGMPNHIHMGAGPPPQFNRMEEMGVQGGRAKRYSSQRQRPVPEPPAPPVHI
SIMEGHYYDPLQFQGPIYTHGDSPAPLPPQGMLVQPGMNLPHPGLHPHQTPAPLPNPGLY
PPPVSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQAPSQV
YGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccggcggcggcagcgcgcttcgcaagacaccgaggacgaggaatctggtgct
tcgggctccgacagcggcggctccccgttgcggggaggcgggagctgcagcggtagcgcc
ggaggcggcggcagcggctctctgccttcacagcgcggaggccgaaccggggcccttcat
ctgcggcgggtggagagcgggggcgccaagagtgctgaggagtcggagtgtgagagtgaa
gatggcattgaaggtgatgctgttctctcggattatgaaagtgcagaagactcggaaggt
gaagaaggtgaatacagtgaagaggaaaactccaaagtggagctgaaatcagaagctaat
gatgctgttaattcttcaacaaaagaagagaagggagaagaaaagcctgacaccaaaagc
actgtgactggagagaggcaaagtggggacggacaggagagcacagagcctgtggagaac
aaagtgggtaaaaagggccctaagcatttggatgatgatgaagatcggaagaatccagca
tacatacctcggaaagggctcttctttgagcatgatcttcgagggcaaactcaggaggag
gaagtcagacccaaggggcgtcagcgaaagctatggaaggatgagggtcgctgggagcat
gacaagttccgggaagatgagcaggccccaaagtcccgacaggagctcattgctctttat
ggttatgacattcgctcagctcataatcctgatgacatcaaacctcgaagaatccggaaa
ccccgatatgggagtcctccacaaagagatccaaactggaacggtgagcggctaaacaag
tctcatcgccaccagggtcttgggggcaccctaccaccaaggacatttattaacaggaat
gctgcaggtaccggccgtatgtctgcacccaggaattattctcgatctgggggcttcaag
gaaggtcgtgctggttttaggcctgtggaagctggtgggcagcatggtggccggtctggt
gagactgttaagcatgagattagttaccggtcacggcgcctagagcagacttctgtgagg
gatccatctccagaagcagatgctccagtgcttggcagtcctgagaaggaagaggcagcc
tcagagccaccagctgctgctcctgatgctgcaccaccaccccctgataggcccattgag
aagaaatcctattcccgggcaagaagaactcgaaccaaagttggagatgcagtcaagctt
gcagaggaggtgccccctcctcctgaaggactgattccagcacctccagtcccagaaacc
accccaactccacctactaagactgggacctgggaagctccggtggattctagtacaagt
ggacttgagcaagatgtggcacaactaaatatagcagaacagaattggagtccggggcag
ccttctttcctgcaaccacgggaacttcgaggtatgcccaaccatatacacatgggagca
ggacctccacctcagtttaaccggatggaagaaatgggtgtccagggtggtcgagccaaa
cgctattcatcccagcggcaaagacctgtgccagagccccccgcccctccagtgcatatc
agtatcatggagggacattactatgatccactgcagttccagggaccaatctatacccat
ggtgacagccctgccccgctgcctccacagggcatgcttgtgcagccaggaatgaacctt
ccccacccaggtttacatccccaccagacaccagctcctctgcccaatccaggcctctat
cccccaccagtgtccatgtctccaggacagccaccacctcagcagttgcttgctcctact
tacttttctgctccaggcgtcatgaactttggtaatcccagttacccttatgctccaggg
gcactgcctcccccaccaccgcctcatctgtatcctaatacacaggccccatcacaggta
tatggaggagtgacctactataaccccgcccagcagcaggtgcagccaaagccctcccca
ccccggaggactccccagccagtcaccatcaagccccctccacctgaggttgtaagcagg
ggttccagttaa

DBGET integrated database retrieval system