KEGG   Homo sapiens (human): 22800Help
Entry
22800             CDS       T01001                                 

Gene name
RRAS2, TC21
Definition
(RefSeq) related RAS viral (r-ras) oncogene homolog 2
  KO
K07830  
Ras-related protein R-Ras2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
cAMP signaling pathway
Phospholipase D signaling pathway
Mitophagy - animal
Autophagy - animal
Apelin signaling pathway
Regulation of actin cytoskeleton
HTLV-I infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    22800 (RRAS2)
   04010 MAPK signaling pathway
    22800 (RRAS2)
   04371 Apelin signaling pathway
    22800 (RRAS2)
   04072 Phospholipase D signaling pathway
    22800 (RRAS2)
   04024 cAMP signaling pathway
    22800 (RRAS2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    22800 (RRAS2)
   04137 Mitophagy - animal
    22800 (RRAS2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    22800 (RRAS2)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    22800 (RRAS2)
  Infectious diseases
   05166 HTLV-I infection
    22800 (RRAS2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   22800 (RRAS2)
  Exosomal proteins of bladder cancer cells
   22800 (RRAS2)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    22800 (RRAS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P62070(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.2
AA seq 204 aa AA seqDB search
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR
AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF
PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE
QECPPSPEPTRKEKDKKGCHCVIF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccggctggcgggacggctccggccaggagaagtaccggctcgtggtggtc
ggcgggggcggcgtgggcaagtcggcgctcaccatccagttcatccagtcctattttgta
acggattatgatccaaccattgaagattcttacacaaagcagtgtgtgatagatgacaga
gcagcccggctagatattttggatacagcaggacaagaagagtttggagccatgagagaa
cagtatatgaggactggcgaaggcttcctgttggtcttttcagtcacagatagaggcagt
tttgaagaaatctataagtttcaaagacagattctcagagtaaaggatcgtgatgagttc
ccaatgattttaattggtaataaagcagatctggatcatcaaagacaggtaacacaggaa
gaaggacaacagttagcacggcagcttaaggtaacatacatggaggcatcagcaaagatt
aggatgaatgtagatcaagctttccatgaacttgtccgggttatcaggaaatttcaagag
caggaatgtcctccttcaccagaaccaacacggaaagaaaaagacaagaaaggctgccat
tgtgtcattttctag

DBGET integrated database retrieval system