KEGG   Homo sapiens (human): 22800Help
Entry
22800             CDS       T01001                                 

Gene name
RRAS2, TC21
Definition
(RefSeq) related RAS viral (r-ras) oncogene homolog 2
  KO
K07830  
Ras-related protein R-Ras2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
cAMP signaling pathway
Phospholipase D signaling pathway
Tight junction
Regulation of actin cytoskeleton
HTLV-I infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    22800 (RRAS2)
   04010 MAPK signaling pathway
    22800 (RRAS2)
   04072 Phospholipase D signaling pathway
    22800 (RRAS2)
   04024 cAMP signaling pathway
    22800 (RRAS2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    22800 (RRAS2)
  Cellular community
   04530 Tight junction
    22800 (RRAS2)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    22800 (RRAS2)
  Infectious diseases
   05166 HTLV-I infection
    22800 (RRAS2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   22800 (RRAS2)
  Exosomal proteins of bladder cancer cells
   22800 (RRAS2)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    22800 (RRAS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.2
AA seq 204 aa AA seqDB search
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR
AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF
PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE
QECPPSPEPTRKEKDKKGCHCVIF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccggctggcgggacggctccggccaggagaagtaccggctcgtggtggtc
ggcgggggcggcgtgggcaagtcggcgctcaccatccagttcatccagtcctattttgta
acggattatgatccaaccattgaagattcttacacaaagcagtgtgtgatagatgacaga
gcagcccggctagatattttggatacagcaggacaagaagagtttggagccatgagagaa
cagtatatgaggactggcgaaggcttcctgttggtcttttcagtcacagatagaggcagt
tttgaagaaatctataagtttcaaagacagattctcagagtaaaggatcgtgatgagttc
ccaatgattttaattggtaataaagcagatctggatcatcaaagacaggtaacacaggaa
gaaggacaacagttagcacggcagcttaaggtaacatacatggaggcatcagcaaagatt
aggatgaatgtagatcaagctttccatgaacttgtccgggttatcaggaaatttcaagag
caggaatgtcctccttcaccagaaccaacacggaaagaaaaagacaagaaaggctgccat
tgtgtcattttctag

DBGET integrated database retrieval system