KEGG   Homo sapiens (human): 22803Help
Entry
22803             CDS       T01001                                 

Gene name
XRN2
Definition
(RefSeq) 5'-3' exoribonuclease 2
  KO
K12619  
5'-3' exoribonuclease 2 [EC:3.1.13.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    22803 (XRN2)
  Folding, sorting and degradation
   03018 RNA degradation
    22803 (XRN2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     22803 (XRN2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     22803 (XRN2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA degradation factors
   5'-3' decay
    5' exonucleases
     22803 (XRN2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    22803 (XRN2)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    22803 (XRN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9H0D6(Tbio)
UniProt: 
Position
20p11.22
AA seq 950 aa AA seqDB search
MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDNLYLDMNGIIH
PCTHPEDKPAPKNEDEMMVAIFEYIDRLFSIVRPRRLLYMAIDGVAPRAKMNQQRSRRFR
ASKEGMEAAVEKQRVREEILAKGGFLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIAD
RLNNDPGWKNLTVILSDASAPGEGEHKIMDYIRRQRAQPNHDPNTHHCLCGADADLIMLG
LATHEPNFTIIREEFKPNKPKPCGLCNQFGHEVKDCEGLPREKKGKHDELADSLPCAEGE
FIFLRLNVLREYLERELTMASLPFTFDVERSIDDWVFMCFFVGNDFLPHLPSLEIRENAI
DRLVNIYKNVVHKTGGYLTESGYVNLQRVQMIMLAVGEVEDSIFKKRKDDEDSFRRRQKE
KRKRMKRDQPAFTPSGILTPHALGSRNSPGSQVASNPRQAAYEMRMQNNSSPSISPNTSF
TSDGSPSPLGGIKRKAEDSDSEPEPEDNVRLWEAGWKQRYYKNKFDVDAADEKFRRKVVQ
SYVEGLCWVLRYYYQGCASWKWYYPFHYAPFASDFEGIADMPSDFEKGTKPFKPLEQLMG
VFPAASGNFLPPSWRKLMSDPDSSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRA
ALEEVYPDLTPEETRRNSLGGDVLFVGKHHPLHDFILELYQTGSTEPVEVPPELCHGIQG
KFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVMLPGARKPAAV
LKPSDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVMPRGSGTGIYSNAAPPPVT
YQGNLYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQ
NAAFQPNQYQMLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYNWN
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgggagtcccggcgttcttccgctggctcagccgcaagtacccgtccatcatagtcaac
tgcgtggaagagaagccaaaagaatgcaatggtgtaaagattccagttgatgccagtaaa
cctaatccaaatgatgtggagtttgataatctgtatttggatatgaatggaatcatccat
ccctgtactcatcctgaagacaaaccagcaccaaaaaatgaagatgaaatgatggttgca
atttttgagtacattgacagacttttcagtattgtaagaccaagaagacttctctacatg
gcaatagatggagtggcaccacgtgctaaaatgaaccagcagcgttcaaggaggttcagg
gcatcaaaagaaggaatggaagcagcagtcgagaagcagcgagtcagggaagaaatattg
gcaaaaggtggctttcttcctccagaagaaataaaagaaagatttgacagcaactgtatt
acaccaggaactgaattcatggacaatcttgctaaatgccttcgctattacatagctgat
cgtttaaataatgaccctgggtggaaaaatttgacagttattttatctgatgctagtgct
cctggtgaaggagaacataaaatcatggattacattagaaggcaaagagcccagcctaac
catgacccaaatactcatcattgtttatgtggagcagatgctgatctcattatgcttggc
cttgccacacatgaaccgaactttaccattattagagaagaattcaaaccaaacaagccc
aaaccatgtggtctttgtaatcagtttggacatgaggtcaaagattgtgaaggtttgcca
agagaaaagaagggaaagcatgatgaacttgccgatagtcttccttgtgcagaaggagag
tttatcttccttcggcttaatgttcttcgtgagtatttggaaagagaactcacaatggcc
agcctaccattcacatttgatgttgagaggagcattgatgactgggttttcatgtgcttc
tttgtgggaaatgacttcctccctcatttgccatcgttagagattagggaaaatgcaatt
gaccgtttggttaacatatacaaaaatgtggtacacaaaactgggggttaccttacagaa
agtggttatgtcaatctgcaaagagtacagatgatcatgttagcagttggtgaagttgag
gatagcatttttaaaaagagaaaggatgatgaggacagttttagaagacgacagaaagaa
aaaagaaagagaatgaagagagatcaaccagctttcactcctagtggaatattaactcct
catgccttgggttcaagaaattcaccaggttctcaagtagccagtaatccgagacaagca
gcctatgaaatgaggatgcagaataactctagtccttcgatatctcctaatacgagtttc
acatctgatggctccccgtctccattaggaggaattaagcgaaaagcagaagacagtgac
agtgaacctgagccagaggataatgtcaggttatgggaagctggctggaagcagcggtac
tacaagaacaaatttgatgtggatgcagctgatgagaaattccgtcggaaagttgtgcag
tcgtacgttgaaggactttgctgggttcttagatattattaccagggctgtgcttcctgg
aagtggtattatccatttcattatgcaccatttgcttcagactttgaaggcattgcagac
atgccatctgattttgagaagggtacgaaaccgtttaaaccactagaacaacttatgggg
gtatttccagctgcaagtggtaattttctacctccatcatggcggaagctcatgagtgat
cctgattctagtataattgacttctatcctgaagattttgctattgatttgaatgggaag
aaatatgcatggcaaggtgttgctctcttgccattcgtggatgagcgaaggctacgagct
gccctagaagaggtatacccagacctcactccagaagagaccagaagaaacagccttgga
ggtgatgtcttatttgtggggaaacatcacccactccatgacttcattttagagctgtac
cagacaggttccacagagccagtggaggtaccccctgaactatgtcatgggattcaagga
aagttttctttggatgaagaagccattcttccagatcaaatagtatgttctcctgttcct
atgttaagggatctgacacagaacactgtagtcagtattaattttaaagacccacagttt
gctgaagattacatttttaaagctgtaatgcttccaggagcaagaaagccagcagcagta
ctgaaacctagtgactgggaaaaatccagcaatggacggcagtggaagcctcagcttggc
tttaaccgtgaccggaggcctgtgcacctggatcaggcagccttcaggactttgggccat
gtgatgccaagaggctcaggaactggcatttacagcaatgctgcaccaccacctgtgact
taccagggaaacttatacaggccgcttttgagaggacaagcccagattccaaaacttatg
tcaaatatgaggccccaggattcctggcgaggtcctcctccccttttccagcagcaaagg
tttgacagaggcgttggggctgaacctctgctcccatggaaccggatgctgcaaacccag
aatgcagccttccagccaaaccagtaccagatgctagctgggcctggtgggtatccaccc
agacgagatgatcgtggagggagacagggatatcccagagaaggaaggaaataccctttg
ccaccaccctcaggaagatacaattggaattaa

DBGET integrated database retrieval system