KEGG   Homo sapiens (human): 2281Help
Entry
2281              CDS       T01001                                 

Gene name
FKBP1B, FKBP12.6, FKBP1L, OTK4, PKBP1L, PPIase
Definition
FK506 binding protein 1B, 12.6 kDa (EC:5.2.1.8)
Orthology
K09568  
FK506-binding protein 1 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     2281 (FKBP1B)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    2281 (FKBP1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p23.3
AA seq 108 aa AA seqDB search
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtggagatcgagaccatctcccccggagacggaaggacattccccaagaagggc
caaacgtgtgtggtgcactacacaggaatgctccaaaatgggaagaagtttgattcatcc
agagacagaaacaaacctttcaagttcagaattggcaaacaggaagtcatcaaaggtttt
gaagagggtgcagcccagatgagcttggggcagagggcgaagctgacctgcacccctgat
gtggcatatggagccacgggccaccccggtgtcatccctcccaatgccaccctcatcttt
gacgtggagctgctcaacttagagtga

DBGET integrated database retrieval system