KEGG   Homo sapiens (human): 22845Help
Entry
22845             CDS       T01001                                 

Gene name
DOLK, CDG1M, DK, DK1, SEC59, TMEM15
Definition
dolichol kinase (EC:2.7.1.108)
Orthology
K00902  
dolichol kinase [EC:2.7.1.108]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Disease
H00118  
Congenital disorders of glycosylation (CDG) type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    22845 (DOLK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.108  dolichol kinase
     22845 (DOLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.11
AA seq 538 aa AA seqDB search
MTRECPSPAPGPGAPLSGSVLAEAAVVFAVVLSIHATVWDRYSWCAVALAVQAFYVQYKW
DRLLQQGSAVFQFRMSANSGLLPASMVMPLLGLVMKERCQTAGNPFFERFGIVVAATGMA
VALFSSVLALGITRPVPTNTCVILGLAGGVIIYIMKHSLSVGEVIEVLEVLLIFVYLNMI
LLYLLPRCFTPGEALLVLGGISFVLNQLIKRSLTLVESQGDPVDFFLLVVVVGMVLMGIF
FSTLFVFMDSGTWASSIFFHLMTCVLSLGVVLPWLHRLIRRNPLLWLLQFLFQTDTRIYL
LAYWSLLATLACLVVLYQNAKRSSSESKKHQAPTIARKYFHLIVVATYIPGIIFDRPLLY
VAATVCLAVFIFLEYVRYFRIKPLGHTLRSFLSLFLDERDSGPLILTHIYLLLGMSLPIW
LIPRPCTQKGSLGGARALVPYAGVLAVGVGDTVASIFGSTMGEIRWPGTKKTFEGTMTSI
FAQIISVALILIFDSGVDLNYSYAWILGSISTVSLLEAYTTQIDNLLLPLYLLILLMA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgacccgagagtgcccatctccggccccggggcctggggctccgctgagtggatcggtg
ctggcagaggcggcagtagtgtttgcagtggtgctgagcatccacgcaaccgtatgggac
cgatactcgtggtgcgccgtggccctcgcagtgcaggccttctacgtccaatacaagtgg
gaccggctgctacagcagggaagcgccgtcttccagttccgaatgtccgcaaacagtggc
ctattgcccgcctccatggtcatgcctttgcttggactagtcatgaaggagcggtgccag
actgctgggaacccgttctttgagcgttttggcattgtggtggcagccactggcatggca
gtggccctcttctcatcagtgttggcgctcggcatcactcgcccagtgccaaccaacact
tgtgtcatcttgggcttggctggaggtgttatcatttatatcatgaagcactcgttgagc
gtgggggaggtgatcgaagtcctggaagtccttctgatcttcgtttatctcaacatgatc
ctgctgtacctgctgccccgctgcttcacccctggtgaggcactgctggtattgggtggc
attagctttgtcctcaaccagctcatcaagcgctctctgacactggtggaaagtcagggg
gacccagtggacttcttcctgctggtggtggtagtagggatggtactcatgggcattttc
ttcagcactctgtttgtcttcatggactcaggcacctgggcctcctccatcttcttccac
ctcatgacctgtgtgctgagccttggtgtggtcctaccctggctgcaccggctcatccgc
aggaatcccctgctctggcttcttcagtttctcttccagacagacacccgcatctacctc
ctagcctattggtctctgctggccaccttggcctgcctggtggtgctgtaccagaatgcc
aagcggtcatcttccgagtccaagaagcaccaggcccccaccatcgcccgaaagtatttc
cacctcattgtggtagccacctacatcccaggtatcatctttgaccggccactgctctat
gtagccgccactgtatgcctggcggtcttcatcttcctggagtatgtgcgctacttccgc
atcaagcctttgggtcacactctacggagcttcctgtccctttttctggatgaacgagac
agtggaccactcattctgacacacatctacctgctcctgggcatgtctcttcccatctgg
ctgatccccagaccctgcacacagaagggtagcctgggaggagccagggccctcgtcccc
tatgccggtgtcctggctgtgggtgtgggtgatactgtggcctccatcttcggtagcacc
atgggggagatccgctggcctggaaccaaaaagacttttgaggggaccatgacatctata
tttgcgcagatcatttctgtagctctgatcttaatctttgacagtggagtggacctaaac
tacagttatgcttggattttggggtccatcagcactgtgtccctcctggaagcatacact
acacagatagacaatctccttctgcctctctacctcctgatattgctgatggcctag

DBGET integrated database retrieval system