KEGG   Homo sapiens (human): 22854Help
Entry
22854             CDS       T01001                                 

Gene name
NTNG1, Lmnt1
Definition
(RefSeq) netrin G1
  KO
K07522  
netrin-G1
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    22854 (NTNG1)
 Organismal Systems
  Development
   04360 Axon guidance
    22854 (NTNG1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   N/0 subfamily
    LRRC4C, NGL1; netrin-G1 ligand [KO:K07523]
     22854 (NTNG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y2I2(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.3
AA seq 539 aa AA seqDB search
MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKY
LKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQS
ATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNM
ASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISS
IGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIEC
YCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTC
HNNVRCLCPAAYTGILCEKLRCEEAGSCGSDSGQGAPPHGSPALLLLTTLLGTASPLVF
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtatttgtcaagattcctgtcgattcatgccctttgggttacggtgtcctcagtgatg
cagccctaccctttggtttggggacattatgatttgtgtaagactcagatttacacggaa
gaagggaaagtttgggattacatggcctgccagccggaatccacggacatgacaaaatat
ctgaaagtgaaactcgatcctccggatattacctgtggagaccctcctgagacgttctgt
gcaatgggcaatccctacatgtgcaataatgagtgtgatgcgagtacccctgagctggca
cacccccctgagctgatgtttgattttgaaggaagacatccctccacattttggcagtct
gccacttggaaggagtatcccaagcctctccaggttaacatcactctgtcttggagcaaa
accattgagctaacagacaacatagttattacctttgaatctgggcgtccagaccaaatg
atcctggagaagtctctcgattatggacgaacatggcagccctatcagtattatgccaca
gactgcttagatgcttttcacatggatcctaaatccgtgaaggatttatcacagcatacg
gtcttagaaatcatttgcacagaagagtactcaacagggtatacaacaaatagcaaaata
atccactttgaaatcaaagacaggttcgcgttttttgctggacctcgcctacgcaatatg
gcttccctctacggacagctggatacaaccaagaaactcagagatttctttacagtcaca
gacctgaggataaggctgttaagaccagccgttggggaaatatttgtagatgagctacac
ttggcacgctacttttacgcgatctcagacataaaggtgcgaggaaggtgcaagtgtaat
ctccatgccactgtatgtgtgtatgacaacagcaaattgacatgcgaatgtgagcacaac
actacaggtccagactgtgggaaatgcaagaagaattatcagggccgaccttggagtcca
ggctcctatctccccatccccaaaggcactgcaaatacctgtatccccagtatttccagt
attggtaattgtgaatgcttcggccactccaatcgatgcagttatatcgatctgctaaat
acagtcatttgcgtgagctgtaaacacaacactagagggcagcactgtgagttatgcagg
ctgggctacttcagaaatgcttctgcacaactggacgatgagaatgtgtgcatagagtgt
tattgtaaccctttgggctcaatccatgatcgttgtaatggctcaggattttgtgagtgt
aagactggaacaacagggcctaagtgtgatgagtgtctgccgggaaattcctggcactac
ggctgtcaaccgaatgtctgcgacaacgagctcctgcactgccagaacggagggacgtgc
cacaacaacgtgcgctgcctgtgcccggccgcatacacgggcatcctctgcgagaagctg
cggtgcgaggaggctggcagctgcggctccgactctggccagggcgcgcccccgcacggc
tccccagcgctgctgctgctgaccacgctgctgggaaccgccagccccctggtgttctag

DBGET integrated database retrieval system