KEGG   Homo sapiens (human): 22858Help
Entry
22858             CDS       T01001                                 

Gene name
ICK, ECO, LCK2, MRK
Definition
(RefSeq) intestinal cell (MAK-like) kinase (EC:2.7.11.22)
  KO
K08828  
intestinal cell (MAK-like) kinase [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Disease
H00972  
Endocrine-cerebro-osteodysplasia syndrome
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     22858 (ICK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  RCK family [OT]
   22858 (ICK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p12.1
AA seq 632 aa AA seqDB search
MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHA
NVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHG
FFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSP
IDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQ
CVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQALRYPYFQVGHPLGSTTQNLQDS
EKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDH
PSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRRWGLISRSTKDSDDWAD
LDDLDFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPT
LRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNS
VGSSSTSSSGLTGNYVPSFLKKEIGSAMQRVHLAPIPDPSPGYSSLKAMRPHPGRPFFHT
QPRSTPGLIPRPPAAQPVHGRTDWASKYASRR
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgaatagatacacaacaatcaggcagctcggggatggaacctacggttccgtcctgctg
ggaagaagcattgagtctggggagctgatcgctattaaaaaaatgaaaagaaaattttat
tcctgggaggaatgcatgaaccttcgggaggttaagtctttaaagaagctcaaccatgcc
aatgtagtcaaattaaaagaagttatcagggaaaatgatcatctttattttatcttcgag
tacatgaaggaaaatctttaccagctcattaaagagagaaataagttgtttcctgagtct
gctataaggaatatcatgtatcagatattacaaggactcgcatttattcacaaacacggc
ttctttcatcgagacttaaagcctgagaacctcctctgcatgggaccagaacttgtgaaa
attgcagactttggtttggcccgagaaatacgatcaaaacctccatatacagattatgta
tctaccagatggtacagggctccagaagtactcctgaggtctaccaactacagctccccc
attgacgtctgggcggtgggctgcatcatggcagaagtttacaccctcaggccactcttc
cctggagccagtgaaattgacacaatattcaaaatttgccaagtgctggggacaccaaaa
aagactgactggcctgaaggctatcaactttcaagtgcaatgaacttccgttggccacag
tgtgtacccaataacttaaagaccttgattcccaatgctagcagtgaagcagtccagctc
ctgagagacatgcttcagtgggatcccaagaaacgaccaacagctagtcaggcacttcga
tatccttacttccaagttggacacccactaggcagcaccacacaaaaccttcaggattca
gaaaaaccacagaaaggcatcctggaaaaggcaggcccacctccttatattaagccagtc
ccacctgcccagccaccagccaagccacacacacgaatttcttcacgacagcatcaagcc
agccagccccctctgcatctcacgtacccctacaaagcagaggtctccaggacagatcac
ccaagccatctccaggaggacaagccaagcccgttgcttttcccatccctccacaacaag
catccacagtcgaaaatcacagctggcctggagcacaaaaatggtgagataaagccaaag
agtaggagaaggtggggtcttatttccaggtcaacaaaggattcagatgattgggctgac
ttggatgacttggatttcagtccatccctcagcaggattgacctgaaaaacaagaaaaga
cagagtgatgacactctctgcaggtttgagagtgttttggacctgaagccctctgagcct
gtgggcacaggaaacagtgcccccacccagacgtcatatcagcggcgagacacgcccacc
ctgagatctgcagccaagcagcactatttgaagcactctcgatacttgcctgggatcagt
ataagaaatggcatactctcgaatccaggcaaggaatttattccacctaatccatggtct
agttctggcttgtctggaaaatcttcagggacaatgtcagtaatcagcaaagtaaattca
gttggttccagctctacaagttctagtggactgactggaaactatgtcccttcctttctg
aaaaaagaaatcggttctgctatgcagagggtacacctagcacctattccagacccttcc
cctggttattcctccctgaaggccatgagacctcatcctgggcgaccattcttccacacc
cagcctagaagcactcctgggttgataccacggcctccagccgcccagccagtgcatggc
cggacagactgggcttccaagtacgcatctcggcgatga

DBGET integrated database retrieval system