KEGG   Homo sapiens (human): 22859Help
Entry
22859             CDS       T01001                                 

Gene name
ADGRL1, CIRL1, CL1, LEC2, LPHN1
Definition
(RefSeq) adhesion G protein-coupled receptor L1
  KO
K04592  
latrophilin 1
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Other
   Latrophilin
    22859 (ADGRL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 1474 aa AA seqDB search
MARLAAVLWNLCVTAVLVTSATQGLSRAGLPFGLMRRELACEGYPIELRCPGSDVIMVEN
ANYGRTDDKICDADPFQMENVQCYLPDAFKIMSQRCNNRTQCVVVAGSDAFPDPCPGTYK
YLEVQYDCVPYKVEQKVFVCPGTLQKVLEPTSTHESEHQSGAWCKDPLQAGDRIYVMPWI
PYRTDTLTEYASWEDYVAARHTTTYRLPNRVDGTGFVVYDGAVFYNKERTRNIVKYDLRT
RIKSGETVINTANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEGNNGRLVVSQLNPYTL
RFEGTWETGYDKRSASNAFMVCGVLYVLRSVYVDDDSEAAGNRVDYAFNTNANREEPVSL
TFPNPYQFISSVDYNPRDNQLYVWNNYFVVRYSLEFGPPDPSAGPATSPPLSTTTTARPT
PLTSTASPAATTPLRRAPLTTHPVGAINQLGPDLPPATAPVPSTRRPPAPNLHVSPELFC
EPREVRRVQWPATQQGMLVERPCPKGTRGIASFQCLPALGLWNPRGPDLSNCTSPWVNQV
AQKIKSGENAANIASELARHTRGSIYAGDVSSSVKLMEQLLDILDAQLQALRPIERESAG
KNYNKMHKRERTCKDYIKAVVETVDNLLRPEALESWKDMNATEQVHTATMLLDVLEEGAF
LLADNVREPARFLAAKENVVLEVTVLNTEGQVQELVFPQEEYPRKNSIQLSAKTIKQNSR
NGVVKVVFILYNNLGLFLSTENATVKLAGEAGPGGPGGASLVVNSQVIAASINKESSRVF
LMDPVIFTVAHLEDKNHFNANCSFWNYSERSMLGYWSTQGCRLVESNKTHTTCACSHLTN
FAVLMAHREIYQGRINELLLSVITWVGIVISLVCLAICISTFCFLRGLQTDRNTIHKNLC
INLFLAELLFLVGIDKTQYEIACPIFAGLLHYFFLAAFSWLCLEGVHLYLLLVEVFESEY
SRTKYYYLGGYCFPALVVGIAAAIDYRSYGTEKACWLRVDNYFIWSFIGPVSFVIVVNLV
FLMVTLHKMIRSSSVLKPDSSRLDNIKSWALGAIALLFLLGLTWAFGLLFINKESVVMAY
LFTTFNAFQGVFIFVFHCALQKKVHKEYSKCLRHSYCCIRSPPGGTHGSLKTSAMRSNTR
YYTGTQSRIRRMWNDTVRKQTESSFMAGDINSTPTLNRGTMGNHLLTNPVLQPRGGTSPY
NTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLPLNGNFNNSYSLRSGDFP
PGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAKGPPPPEPPVPPVPGGGGEE
EAGGPGGADRAEIELLYKALEEPLLLPRAQSVLYQSDLDESESCTAEDGATSRPLSSPPG
RDSLYASGANLRDSPSYPDSSPEGPSEALPPPPPAPPGPPEIYYTSRPPALVARNPLQGY
YQVRRPSHEGYLAAPGLEGPGPDGDGQMQLVTSL
NT seq 4425 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcctagccgcagtgctctggaatctgtgtgtcaccgccgtcctggtcacctcg
gccacccaaggcctgagccgggccgggctcccgttcgggctgatgcgccgggagctggcg
tgtgaaggctaccccatcgagctgcggtgccccggcagcgacgtcatcatggtggagaat
gccaactacgggcgcacggacgacaagatttgcgatgctgaccctttccagatggagaat
gtgcagtgctacctgccggacgccttcaagatcatgtcacagaggtgtaacaaccgcacc
cagtgcgtggtggtcgccggctcggatgcctttcctgacccctgtcctgggacctacaag
tacctggaggtgcagtacgactgtgtcccctacaaagtggagcagaaagtcttcgtgtgc
ccagggaccctgcagaaggtgctggagcccacctcgacacacgagtcagagcaccagtct
ggcgcatggtgcaaggacccgctgcaggcgggtgaccgcatctacgtgatgccctggatc
ccctaccgcacggacacactgactgagtatgcctcgtgggaggactacgtggccgcccgc
cacaccaccacctaccgcctgcccaaccgcgtggatggcacaggctttgtggtctacgat
ggtgccgtcttctacaacaaggagcgcacgcgcaacatcgtcaagtatgacctacggacg
cgcatcaagagcggggagacggtcatcaataccgccaactaccatgacacctcgccctac
cgctggggcggaaagaccgacattgacctggcggtggacgagaacgggctgtgggtcatc
tacgccactgagggcaacaacgggcggctggtggtgagccagctgaacccctacacactg
cgctttgagggcacgtgggagacgggttacgacaagcgctcggcatccaacgccttcatg
gtgtgtggggtcctgtacgtcctgcgttccgtgtacgtggatgatgacagcgaggcggct
ggcaaccgcgtggactatgccttcaacaccaatgccaaccgcgaggagcctgtcagcctc
accttccccaacccctaccagttcatctcctccgttgactacaaccctcgcgacaaccag
ctgtacgtctggaacaactatttcgtggtgcgctacagcctggagttcgggccgcccgac
cccagtgctggcccagccacttccccacccctcagcacgaccaccacagccaggcccacg
cccctcaccagcacagcctcgcccgcagccaccaccccgctccgccgggcacccctcacc
acgcacccagtgggtgccatcaaccagctgggacctgatctgcctccagccacagcccca
gtccccagcacccggcggcccccagccccgaatctacacgtgtcccctgagctcttctgc
gagccccgagaggtacggcgggtccagtggccggccacccagcagggcatgctggtggag
aggccctgccccaaggggactcgaggaattgcctccttccagtgtctaccagccttgggg
ctctggaacccccggggccctgacctcagcaactgcacctccccctgggtcaaccaggtg
gcccagaagatcaagagtggggagaacgcggccaacatcgccagcgagctggcccgacac
acccggggctccatctacgcgggggacgtctcctcctctgtgaagctgatggagcagctg
ctggacatcctggatgcccagctgcaggccctgcggcccatcgagcgcgagtcagccggc
aagaactacaacaagatgcacaagcgagagagaacttgtaaggattatatcaaggccgtg
gtggagacagtggacaatctgctccggccagaagctctggagtcctggaaggacatgaat
gccacggagcaggtgcacacggccaccatgctcctcgacgtcctggaggagggcgccttc
ctgctggccgacaatgtcagggagcctgcccgcttcctggctgccaaggagaacgtggtc
ctggaggtcacagtcctgaacacagagggccaggtgcaggagctggtgttcccccaggag
gagtacccgagaaagaactccatccagctgtctgccaaaaccatcaagcagaacagccgc
aatggggtggtcaaagttgtcttcatcctctacaacaacctgggcctcttcctgtccacg
gagaatgccacagtgaagctggccggcgaagcaggcccgggtggccctgggggcgcctct
ctagtggtgaactcacaggtcatcgcagcatccatcaacaaggagtccagccgcgtcttc
ctcatggaccctgtcatcttcaccgtggcccacctggaggacaagaaccacttcaatgct
aactgctccttctggaactactcggagcgttccatgctgggctactggtcgacccaaggc
tgccgcctggtggagtccaacaagacccataccacgtgtgcctgcagccacctcaccaac
ttcgctgtgctcatggctcaccgtgagatctaccagggccgcatcaacgagctgctgctg
tcggtcatcacctgggtgggcattgtgatctccctggtctgcttggccatctgcatctcc
accttctgcttcctgcgggggctgcagaccgaccgcaacaccatccacaagaacctgtgc
atcaacctcttcctggctgagctgctcttcctggtcgggatcgacaagactcagtatgag
attgcctgccccatcttcgccggcctgctgcactatttcttcctggctgccttctcctgg
ctgtgcctggagggcgtgcacctctacctgctactagtggaggtgtttgagagcgagtat
tcccgcaccaagtactactacctgggtggctactgcttcccggccctggtggtgggcatc
gcggctgccattgactaccgcagctacggcaccgagaaggcctgctggctccgagtggac
aattacttcatctggagtttcatcgggccagtctccttcgttatcgtggtcaacctggtg
ttcctcatggtgaccctgcacaagatgatccgaagctcatctgtgctcaagcccgactcc
agccgcctggacaacattaaatcctgggcgctgggggccatcgcgctgctgttcctgctg
ggcctcacctgggctttcggcctcctcttcatcaacaaggagtcggtggtcatggcctat
ctcttcaccaccttcaacgccttccagggggtcttcatcttcgtctttcactgcgcctta
cagaagaaggtgcacaaggagtacagcaagtgcctgcgtcactcctactgctgcatccgc
tccccacccgggggcactcacggatccctcaagacctcagccatgcgaagcaacacccgc
tactacacagggacccagagccgaattcggaggatgtggaatgacactgtgaggaaacag
acggagtcctccttcatggcgggtgacatcaacagcacccccaccctgaaccgaggtacc
atggggaaccacctgctgaccaaccccgtgctgcagccccgtgggggcaccagtccctac
aacaccctcatcgccgagtcagtgggcttcaatccctcctcgccccctgtcttcaactcc
ccagggagctaccgggaacccaagcaccccttgggaggccgggaagcctgtggcatggac
accctgcccctgaacggcaacttcaataacagttactccttgcgaagtggggatttccct
cccggggatgggggccctgagccgccccgaggccggaacctagccgatgcggcggccttt
gagaagatgatcatctcagagctggtgcacaacaacctgcgggggagcagcagcgcggcc
aagggccctccaccgcctgagccccctgtgccacctgtgccagggggcgggggcgaggaa
gaggcgggcgggcccgggggtgctgaccgggccgagattgaacttctctataaggccctg
gaggagcctctgctgctgccccgggcccagtcggtgctgtaccagagcgatctggacgag
tcggagagctgcacggccgaggacggcgccaccagccggcccctctcctcccctcctggc
cgggactccctctatgccagcggggccaacctgcgggactcaccctcctacccggacagc
agccctgaggggcccagtgaggccctgcccccaccccctcccgcaccccccggccccccc
gaaatctactacacctcgcgcccgccagccctggtggcccggaatcccctgcagggctac
taccaggtgcggcgtcctagccacgagggctacctggcagccccaggccttgaggggcca
gggcccgatggggacgggcagatgcagctggtcaccagtctctga

DBGET integrated database retrieval system