KEGG   Homo sapiens (human): 22861Help
Entry
22861             CDS       T01001                                 

Gene name
NLRP1, CARD7, CIDED, CLR17.1, DEFCAP, DEFCAP-L/S, NAC, NALP1, PP1044, SLEV1, VAMAS1
Definition
NLR family, pyrin domain containing 1
Orthology
K12798  
NACHT, LRR and PYD domains-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
Disease
H01372  
Vitiligo
Class
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.2
AA seq 1375 aa AA seqDB search
MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQ
YGEQRAWDLALHTWEQMGLRSLCAQAQEGAGHSPSFPYSPSEPHLGSPSQPTSTAVLMPW
IHELPAGCTQGSERRVLRQLPDTSGRRWREISASLLYQALPSSPDHESPSQESPNAPTST
AVLGSWGSPPQPSLAPREQEAPGTQWPLDETSGIYYTEIREREREKSEKGRPPWAAVVGT
PPQAHTSLQPHHHPWEPSVRESLCSTWPWKNEDFNQKFTQLLLLQRPHPRSQDPLVKRSW
PDYVEENRGHLIEIRDLFGPGLDTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDR
FQHVFYFSCRELAQSKVVSLAELIGKDGTATPAPIRQILSRPERLLFILDGVDEPGWVLQ
EPSSELCLHWSQPQPADALLGSLLGKTILPEASFLITARTTALQNLIPSLEQARWVEVLG
FSESSRKEYFYRYFTDERQAIRAFRLVKSNKELWALCLVPWVSWLACTCLMQQMKRKEKL
TLTSKTTTTLCLHYLAQALQAQPLGPQLRDLCSLAAEGIWQKKTLFSPDDLRKHGLDGAI
ISTFLKMGILQEHPIPLSYSFIHLCFQEFFAAMSYVLEDEKGRGKHSNCIIDLEKTLEAY
GIHGLFGASTTRFLLGLLSDEGEREMENIFHCRLSQGRNLMQWVPSLQLLLQPHSLESLH
CLYETRNKTFLTQVMAHFEEMGMCVETDMELLVCTFCIKFSRHVKKLQLIEGRQHRSTWS
PTMVVLFRWVPVTDAYWQILFSVLKVTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLLE
TLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQ
LVSCGLTSDCCQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEGLRHPACKLIRLGLDQ
TTLSDEMRQELRALEQEKPQLLIFSRRKPSVMTPTEGLDTGEMSNSTSSLKRQRLGSERA
ASHVAQANLKLLDVSKIFPIAEIAGKSHEESSPEVVPVELLCVPSPASQGDLHTKPLGTD
DDFWGPTGPVATEVVDKEKNLYRVHFPVAGSYRWPNTGLCFVMREAVTVEIEFCVWDQFL
GEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEEGMLLEK
PARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSD
CSIRKAIDDLEMKFQFVRIHKPPPLTPLYMGCRYTVSGSGSGMLEILPKELELCYRSPGE
DQLFSEFYVGHLGSGIRLQVKDKKDETLVWEALVKPGRNTSQPWNLRCNRDARRY
NT seq 4128 nt NT seq  +upstreamnt  +downstreamnt
atggctggcggagcctggggccgcctggcctgttacttggagttcctgaagaaggaggag
ctgaaggagttccagcttctgctcgccaataaagcgcactccaggagctcttcgggtgag
acacccgctcagccagagaagacgagtggcatggaggtggcctcgtacctggtggctcag
tatggggagcagcgggcctgggacctagccctccatacctgggagcagatggggctgagg
tcactgtgcgcccaagcccaggaaggggcaggccactctccctcattcccctacagccca
agtgaaccccacctggggtctcccagccaacccacctccaccgcagtgctaatgccctgg
atccatgaattgccggcggggtgcacccagggctcagagagaagggttttgagacagctg
cctgacacatctggacgccgctggagagaaatctctgcctcactcctctaccaagctctt
ccaagctccccagaccatgagtctccaagccaggagtcacccaacgcccccacatccaca
gcagtgctggggagctggggatccccacctcagcccagcctagcacccagagagcaggag
gctcctgggacccaatggcctctggatgaaacgtcaggaatttactacacagaaatcaga
gaaagagagagagagaaatcagagaaaggcaggcccccatgggcagcggtggtaggaacg
cccccacaggcgcacaccagcctacagccccaccaccacccatgggagccttctgtgaga
gagagcctctgttccacatggccctggaaaaatgaggattttaaccaaaaattcacacag
ctgctacttctacaaagacctcaccccagaagccaagatcccctggtcaagagaagctgg
cctgattatgtggaggagaatcgaggacatttaattgagatcagagacttatttggccca
ggcctggatacccaagaacctcgcatagtcatactgcagggggctgctggaattgggaag
tcaacactggccaggcaggtgaaggaagcctgggggagaggccagctgtatggggaccgc
ttccagcatgtcttctacttcagctgcagagagctggcccagtccaaggtggtgagtctc
gctgagctcatcggaaaagatgggacagccactccggctcccattagacagatcctgtct
aggccagagcggctgctcttcatcctcgatggtgtagatgagccaggatgggtcttgcag
gagccgagttctgagctctgtctgcactggagccagccacagccggcggatgcactgctg
ggcagtttgctggggaaaactatacttcccgaggcatccttcctgatcacggctcggacc
acagctctgcagaacctcattccttctttggagcaggcacgttgggtagaggtcctgggg
ttctctgagtccagcaggaaggaatatttctacagatatttcacagatgaaaggcaagca
attagagcctttaggttggtcaaatcaaacaaagagctctgggccctgtgtcttgtgccc
tgggtgtcctggctggcctgcacttgcctgatgcagcagatgaagcggaaggaaaaactc
acactgacttccaagaccaccacaaccctctgtctacattaccttgcccaggctctccaa
gctcagccattgggaccccagctcagagacctctgctctctggctgctgagggcatctgg
caaaaaaagacccttttcagtccagatgacctcaggaagcatgggttagatggggccatc
atctccaccttcttgaagatgggtattcttcaagagcaccccatccctctgagctacagc
ttcattcacctctgtttccaagagttctttgcagcaatgtcctatgtcttggaggatgag
aaggggagaggtaaacattctaattgcatcatagatttggaaaagacgctagaagcatat
ggaatacatggcctgtttggggcatcaaccacacgtttcctattgggcctgttaagtgat
gagggggagagagagatggagaacatctttcactgccggctgtctcaggggaggaacctg
atgcagtgggtcccgtccctgcagctgctgctgcagccacactctctggagtccctccac
tgcttgtacgagactcggaacaaaacgttcctgacacaagtgatggcccatttcgaagaa
atgggcatgtgtgtagaaacagacatggagctcttagtgtgcactttctgcattaaattc
agccgccacgtgaagaagcttcagctgattgagggcaggcagcacagatcaacatggagc
cccaccatggtagtcctgttcaggtgggtcccagtcacagatgcctattggcagattctc
ttctccgtcctcaaggtcaccagaaacctgaaggagctggacctaagtggaaactcgctg
agccactctgcagtgaagagtctttgtaagaccctgagacgccctcgctgcctcctggag
accctgcggttggctggctgtggcctcacagctgaggactgcaaggaccttgcctttggg
ctgagagccaaccagaccctgaccgagctggacctgagcttcaatgtgctcacggatgct
ggagccaaacacctttgccagagactgagacagccgagctgcaagctacagcgactgcag
ctggtcagctgtggcctcacgtctgactgctgccaggacctggcctctgtgcttagtgcc
agccccagcctgaaggagctagacctgcagcagaacaacctggatgacgttggcgtgcga
ctgctctgtgaggggctcaggcatcctgcctgcaaactcatacgcctggggctggaccag
acaactctgagtgatgagatgaggcaggaactgagggccctggagcaggagaaacctcag
ctgctcatcttcagcagacggaaaccaagtgtgatgacccctactgagggcctggatacg
ggagagatgagtaatagcacatcctcactcaagcggcagagactcggatcagagagggcg
gcttcccatgttgctcaggctaatctcaaactcctggacgtgagcaagatcttcccaatt
gctgagattgcaggcaagagccacgaggaaagctccccagaggtagtaccggtggaactc
ttgtgcgtgccttctcctgcctctcaaggggacctgcatacgaagcctttggggactgac
gatgacttctggggccccacggggcctgtggctactgaggtagttgacaaagaaaagaac
ttgtaccgagttcacttccctgtagctggctcctaccgctggcccaacacgggtctctgc
tttgtgatgagagaagcggtgaccgttgagattgaattctgtgtgtgggaccagttcctg
ggtgagatcaacccacagcacagctggatggtggcagggcctctgctggacatcaaggct
gagcctggagctgtggaagctgtgcacctccctcactttgtggctctccaagggggccat
gtggacacatccctgttccaaatggcccactttaaagaggaggggatgctcctggagaag
ccagccagggtggagctgcatcacatagttctggaaaaccccagcttctcccccttggga
gtcctcctgaaaatgatccataatgccctgcgcttcattcccgtcacctctgtggtgttg
ctttaccaccgcgtccatcctgaggaagtcaccttccacctctacctgatcccaagtgac
tgctccattcggaaggccatagatgatctagaaatgaaattccagtttgtgcgaatccac
aagccacccccgctgaccccactttatatgggctgtcgttacactgtgtctgggtctggt
tcagggatgctggaaatactccccaaggaactggagctctgctatcgaagccctggagaa
gaccagctgttctcggagttctacgttggccacttgggatcagggatcaggctgcaagtg
aaagacaagaaagatgagactctggtgtgggaggccttggtgaaaccaggaaggaacacc
agccagccgtggaacctcaggtgcaacagagacgccaggagatactag

DBGET integrated database retrieval system