KEGG   Homo sapiens (human): 22871Help
Entry
22871             CDS       T01001                                 

Gene name
NLGN1, NL1
Definition
(RefSeq) neuroligin 1
  KO
K07378  
neuroligin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    22871 (NLGN1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    22871 (NLGN1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  NRXN; neurexin [KO:K07377]
   22871 (NLGN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8N2Q7(Tbio)
UniProt: 
Position
3q26.31
AA seq 823 aa AA seqDB search
MALPRCTWPNYVWRAVMACLVHRGLGAPLTLCMLGCLLQAGHVLSQKLDDVDPLVATNFG
KIRGIKKELNNEILGPVIQFLGVPYAAPPTGERRFQPPEPPSPWSDIRNATQFAPVCPQN
IIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTEDDIRDSGGPKPVMVYIH
GGSYMEGTGNLYDGSVLASYGNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRW
TSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTAL
SSWAVSFQPAKYARMLATKVGCNVSDTVELVECLQKKPYKELVDQDIQPARYHIAFGPVI
DGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVENIVDSDDGISASDFDFAVSNFVD
NLYGYPEGKDVLRETIKFMYTDWADRHNPETRRKTLLALFTDHQWVAPAVATADLHSNFG
SPTYFYAFYHHCQTDQVPAWADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVM
TYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRA
NKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQ
QPSPFSVDQRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKRRHDVHRRCSPQRTTTN
DLTHAQEEEIMSLQMKHTDLDHECESIHPHEVVLRTACPPDYTLAMRRSPDDVPLMTPNT
ITMIPNTIPGIQPLHTFNTFTGGQNNTLPHPHPHPHSHSTTRV
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcccagatgcacgtggccaaattatgtttggagagcagtgatggcatgcttg
gtacaccggggattgggtgccccattgactctctgtatgttgggatgtttgcttcaggct
ggccatgtgctatcacaaaaattggatgatgtggacccactggtggctaccaactttgga
aagataagagggattaagaaggaactcaataatgaaattttggggcctgttattcaattt
cttggggttccatatgcagccccaccaacaggggaacgtcgttttcagcctccagaacca
ccatctccctggtcagatatcagaaatgccactcaatttgctcctgtgtgtccccagaat
atcattgatggcagattgccagaagtcatgcttcctgtgtggtttactaataacttggat
gtggtttcatcatatgtgcaagaccagagcgaagactgcctatatttaaatatatatgtc
ccgactgaggatgatattcgggacagtgggggtcccaaaccagtgatggtgtatatccat
ggtggctcatatatggaaggtactggaaatttatatgatggaagtgtcttggcaagttat
ggcaatgtgatcgtcatcacagtcaactatcgacttggagtactcggtttcttgagtaca
ggcgatcaggctgcaaaggggaactatggactccttgatctcatacaagctttaagatgg
actagtgaaaacattggattctttggtggtgaccccttaagaatcactgtttttggatct
ggtgctgggggttcatgtgtcaacctgctgactttatcccattattctgaaggtaaccgt
tggagcaattcaaccaaaggactttttcaacgagcaatagctcaaagtggaacagccctt
tccagctgggctgttagttttcaacctgcaaaatatgctagaatgttggccacaaaagtt
ggttgcaatgtttcagatacagtagagttagtggaatgcctacagaagaagccttacaaa
gaacttgttgaccaagatattcaaccagctcgataccacatagcctttggacctgtgatt
gatggtgatgtaataccagacgacccccagatattgatggagcaaggagagtttctcaac
tatgatataatgttaggagtgaaccaaggggaagggttaaaatttgttgaaaatatagta
gatagcgatgatggtatatcagctagtgattttgactttgctgtttcaaattttgttgat
aatttatatggatatcctgaaggcaaagatgttttgagagaaaccattaagttcatgtat
actgactgggctgaccgtcataaccctgaaaccagaagaaagacattactggctttgttt
acggaccatcagtgggtggcaccagctgtagccacagcggatcttcactcaaactttggt
tcacctacgtacttctatgccttttaccatcattgccaaacagatcaggttccagcttgg
gctgatgcagcccacggagacgaggttccctatgtactgggaatccccatgattggccct
acagagttatttccttgcaatttctccaaaaatgatgtgatgctgagtgcagttgtaatg
acatactggacaaattttgctaaaactggtgacccaaatcaaccagtccctcaagacacg
aaattcattcataccaaacccaaccgttttgaagaagtagcatggaccagatattcccag
aaagaccaactttatctccatattggattaaaaccaagagttaaagaacattacagagcc
aataaggtgaacctctggttggagttggtacctcatctgcataatctcaatgacatttct
cagtatacctctacaacaactaaagtgccatcaactgacatcactttcagacctacgaga
aaaaattctgtacctgtcacgtcagcctttcccactgccaagcaggatgatcccaaacaa
caaccaagtccattttcagtggatcaaagggactactcaacagagctgagtgtcactatt
gcagttggagcatcactgctgtttctgaacatcttggcctttgcagccctgtactacaaa
aaggataagaggagacatgatgttcacaggagatgcagccctcagcgcactactaccaat
gatctaacccatgcacaagaagaggaaatcatgtccctccaaatgaagcacactgatttg
gatcatgaatgtgagtccattcatccacatgaggtggttcttcggaccgcctgtccccca
gattacacactagctatgaggaggtcacctgatgatgttcccttaatgacacccaacacc
attacaatgattcccaacactataccagggattcagcccttacacacattcaatacattt
actggaggacagaacaatactctgccccatccccatccccacccccattcacattcaaca
accagggtatag

DBGET integrated database retrieval system