KEGG   Homo sapiens (human): 22872Help
Entry
22872             CDS       T01001                                 

Gene name
SEC31A, ABP125, ABP130, HSPC275, HSPC334, SEC31L1
Definition
(RefSeq) SEC31 homolog A, COPII coat complex component
  KO
K14005  
protein transport protein SEC31
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Module
COPII complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22872 (SEC31A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21.22
AA seq 1220 aa AA seqDB search
MKLKEVDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSC
ATFSSSHRYHKLIWGPYKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQNDK
HTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQV
QHILASASPSGRATVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDVATQMVLASEDDRLPV
IQMWDLRFASSPLRVLENHARGILAIAWSMADPELLLSCGKDAKILCSNPNTGEVLYELP
TNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLSSSFGNLDPFG
TGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVRMPSHQGAEQ
QQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKIDASQTEFEKNVWSFLKVN
FEDDSRGKYLELLGYRKEDLGKKIALALNKVDGANVALKDSDQVAQSDGEESPAAEEQLL
GEHIKEEKEESEFLPSSGGTFNISVSGDIDGLITQALLTGNFESAVDLCLHDNRMADAII
LAIAGGQELLARTQKKYFAKSQSKITRLITAVVMKNWKEIVESCDLKNWREALAAVLTYA
KPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDL
IEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIM
QLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPP
PGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQPYQPAQPYPFGTGGSAMYRPQQPVA
PPTSNAYPNTPYISSASSYTGQSQLYAAQHQASSPTSSPATSFPPPPSSGASFQHGGPGA
PPSSSAYALPPGTTGTLPAASELPASQRTGPQNGWNDPPALNRVPKKKKMPENFMPPVPI
TSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTGMPPSFS
KPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSATDPQTK
RKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVSTSNFSE
TSAFMPVLKVVLTQANKLGV
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaggaagtagatcgtacagccatgcaggcatggagccctgcccagaatcac
cccatttacctagcaacaggaacatctgctcagcaattggatgcaacatttagtacgaat
gcttcccttgagatatttgaattagacctctctgatccatccttggatatgaaatcttgt
gccacattctcctcttctcacaggtaccacaagttgatttgggggccttataaaatggat
tccaaaggagatgtctctggagttctgattgcaggtggtgaaaatggaaatattattctc
tatgatccttctaaaattatagctggagacaaggaagttgtgattgcccagaatgacaag
catactggcccagtgagagccttggatgtgaacattttccagactaatctggtagcttct
ggtgctaatgaatctgaaatctacatatgggatctaaataattttgcaaccccaatgaca
ccaggagccaaaacacagccgccagaagatatcagctgcattgcatggaacagacaagtt
cagcatattttagcatcagccagtcccagtggccgggccactgtatgggatcttagaaaa
aatgagccaatcatcaaagtcagtgaccatagtaacagaatgcattgttctgggttggca
tggcatcctgatgttgctactcagatggtccttgcctccgaggatgaccggttaccagtg
atccagatgtgggatcttcgatttgcttcctctccacttcgtgtcctggaaaaccatgcc
agggggattttggcaattgcttggagcatggcagatcctgaattgttactgagctgtgga
aaagatgctaagattctctgctccaatccaaacacaggagaggtgttatatgaacttccc
accaacacacagtggtgcttcgatattcagtggtgtccccgaaatcctgctgtcttatca
gctgcttcgtttgatgggcgtatcagtgtttattctatcatgggaggaagcacagatggt
ttaagacagaaacaagttgacaagctttcatcatcttttgggaatcttgatccctttggc
acaggacagccccttcctccgttacaaattccacagcagactgctcagcatagtatagtg
ctgcctctgaagaagccgcccaagtggattcgaaggcctgttggtgcttctttttcattt
ggaggcaaactggttacgtttgagaatgtcagaatgccttctcatcagggagctgagcag
cagcagcagcagcaccatgtgttcattagtcaggttgtaacagaaaaggagttcctcagc
cgatcagaccaacttcagcaggctgtgcagtcacaaggatttatcaattattgccaaaaa
aaaattgatgcttctcagactgaatttgagaaaaatgtgtggtcctttttgaaggtaaac
tttgaggatgattctcgtggaaaataccttgaacttctaggatacagaaaagaagatcta
ggaaagaagattgctttggccttgaacaaagtggatggagccaatgtggctcttaaagac
tctgaccaagtagcacagagtgatggggaggagagccctgctgctgaagagcagctcttg
ggagagcacattaaagaggaaaaagaagaatctgaatttctaccctcatctggaggaaca
tttaatatctctgtcagtggggacattgatggtttaattactcaggctttgctgacgggc
aattttgagagtgctgttgacctttgtttacatgataaccgcatggccgatgccattata
ttggccatagcaggtggacaagaactcttggctcgaacccagaaaaaatacttcgcaaaa
tcccaaagcaaaattaccaggctcatcactgcagtggtgatgaagaactggaaagagatt
gttgagtcttgtgatcttaaaaattggagagaggctttagctgcagtattgacttatgca
aagccggatgaattttcagccctttgtgatcttttgggaaccaggcttgaaaatgaagga
gatagcctcctgcagactcaagcatgtctctgctatatttgtgcagggaatgtagagaaa
ttagttgcatgttggactaaagctcaagatggaagccaccctttgtcacttcaggatctg
attgagaaagttgtcatcctgcgaaaagctgtgcaactcactcaagccatggacactagt
actgtaggagttctcttggctgcgaagatgagtcagtatgccaatttgttggcagctcag
ggcagtattgctgcagccttggcttttcttcctgacaacaccaaccagccaaatatcatg
cagcttcgtgacagactttgtagagcacaaggagagcctgtagcaggacatgaatcacct
aaaattccgtacgagaaacagcagctccccaagggcaggcctggaccagttgctggccac
caccagatgccaagagttcaaactcaacaatattatccccatggagaaaatcctccacct
ccgggtttcataatgcatggaaatgttaatccaaatgctgctggtcagcttcccacatct
ccaggtcatatgcacacccaggtaccaccttatccacagccacagccttatcaaccagcc
cagccgtatcccttcggaacaggggggtcagcaatgtatcgacctcagcagcctgttgct
cctcctacttcaaacgcttaccctaacaccccttacatatcttctgcttcttcctatact
gggcagtctcagctgtacgcagcacagcaccaggcctcttcacctacctccagccctgct
acttctttccctcctcccccttcctctggagcatccttccagcatggcggaccaggagct
ccaccatcatcttcagcttatgcactgcctcctggaacaacaggtacactgcctgctgcc
agtgagctgcctgcgtcccaaagaacaggtcctcagaatggttggaatgaccctccagct
ttgaacagagtacccaaaaagaagaagatgcctgaaaacttcatgcctcctgttcccatc
acatcaccaatcatgaacccgttgggtgacccccagtcacaaatgctgcagcaacagcct
tcagctccagtaccactgtcaagccagtcttcattcccacagccacatcttccaggtggc
cagcccttccatggcgtacagcaacctcttggtcaaacaggcatgccaccatctttttca
aagcccaatattgaaggtgccccaggggctcctattggaaataccttccagcatgtgcag
tctttgccaacaaaaaaaattaccaagaaacctattccagatgagcacctcattctaaag
accacatttgaggatcttattcagcgctgcctttcttcagcaacagaccctcaaaccaag
aggaagctagatgatgccagcaaacgtttggagtttctgtatgataaacttagggaacag
acactttcaccaacaatcaccagtggtttacacaacattgcaaggagcattgaaactcga
aactactcagaaggattgaccatgcatacccacatagttagcaccagcaacttcagtgag
acctctgctttcatgccagttctcaaagttgttctcacccaggccaataagctgggtgtc
taa

DBGET integrated database retrieval system