KEGG   Homo sapiens (human): 22872Help
Entry
22872             CDS       T01001                                 

Gene name
SEC31A, ABP125, ABP130, HSPC334, SEC31L1
Definition
SEC31 homolog A (S. cerevisiae)
Orthology
K14005  
protein transport protein SEC31
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Module
COPII complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22872 (SEC31A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21.22
AA seq 1106 aa AA seqDB search
MKLKEVDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSC
ATFSSSHRYHKLIWGPYKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQNDK
HTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQV
QHILASASPSGRATVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDVATQMVLASEDDRLPV
IQMWDLRFASSPLRVLENHARGILAIAWSMADPELLLSCGKDAKILCSNPNTGEVLYELP
TNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLSSSFGNLDPFG
TGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVRMPSHQGAEQ
QQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKIDASQTEFEKNVWSFLKVN
FEDDSRGKYLELLGYRKEDLGKKIALALNKVDGANVALKDSDQVAQSDGEESPAAEEQLL
GEHIKEEKEESEFLPSSGGTFNISVSGDIDGLITQALLTGNFESAVDLCLHDNRMADAII
LAIAGGQELLARTQKKYFAKSQSKITRLITAVVMKNWKEIVESCDLKNWREALAAVLTYA
KPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDL
IEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIM
QLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPP
PGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQRPQNGWNDPPALNRVPKKKKMPENF
MPPVPITSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTG
MPPSFSKPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSA
TDPQTKRKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVS
TSNFSETSAFMPVLKVVLTQANKLGV
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaggaagtagatcgtacagccatgcaggcatggagccctgcccagaatcac
cccatttacctagcaacaggaacatctgctcagcaattggatgcaacatttagtacgaat
gcttcccttgagatatttgaattagacctctctgatccatccttggatatgaaatcttgt
gccacattctcctcttctcacaggtaccacaagttgatttgggggccttataaaatggat
tccaaaggagatgtctctggagttctgattgcaggtggtgaaaatggaaatattattctc
tatgatccttctaaaattatagctggagacaaggaagttgtgattgcccagaatgacaag
catactggcccagtgagagccttggatgtgaacattttccagactaatctggtagcttct
ggtgctaatgaatctgaaatctacatatgggatctaaataattttgcaaccccaatgaca
ccaggagccaaaacacagccgccagaagatatcagctgcattgcatggaacagacaagtt
cagcatattttagcatcagccagtcccagtggccgggccactgtatgggatcttagaaaa
aatgagccaatcatcaaagtcagtgaccatagtaacagaatgcattgttctgggttggca
tggcatcctgatgttgctactcagatggtccttgcctccgaggatgaccggttaccagtg
atccagatgtgggatcttcgatttgcttcctctccacttcgtgtcctggaaaaccatgcc
agggggattttggcaattgcttggagcatggcagatcctgaattgttactgagctgtgga
aaagatgctaagattctctgctccaatccaaacacaggagaggtgttatatgaacttccc
accaacacacagtggtgcttcgatattcagtggtgtccccgaaatcctgctgtcttatca
gctgcttcgtttgatgggcgtatcagtgtttattctatcatgggaggaagcacagatggt
ttaagacagaaacaagttgacaagctttcatcatcttttgggaatcttgatccctttggc
acaggacagccccttcctccgttacaaattccacagcagactgctcagcatagtatagtg
ctgcctctgaagaagccgcccaagtggattcgaaggcctgttggtgcttctttttcattt
ggaggcaaactggttacgtttgagaatgtcagaatgccttctcatcagggagctgagcag
cagcagcagcagcaccatgtgttcattagtcaggttgtaacagaaaaggagttcctcagc
cgatcagaccaacttcagcaggctgtgcagtcacaaggatttatcaattattgccaaaaa
aaaattgatgcttctcagactgaatttgagaaaaatgtgtggtcctttttgaaggtaaac
tttgaggatgattctcgtggaaaataccttgaacttctaggatacagaaaagaagatcta
ggaaagaagattgctttggccttgaacaaagtggatggagccaatgtggctcttaaagac
tctgaccaagtagcacagagtgatggggaggagagccctgctgctgaagagcagctcttg
ggagagcacattaaagaggaaaaagaagaatctgaatttctaccctcatctggaggaaca
tttaatatctctgtcagtggggacattgatggtttaattactcaggctttgctgacgggc
aattttgagagtgctgttgacctttgtttacatgataaccgcatggccgatgccattata
ttggccatagcaggtggacaagaactcttggctcgaacccagaaaaaatacttcgcaaaa
tcccaaagcaaaattaccaggctcatcactgcagtggtgatgaagaactggaaagagatt
gttgagtcttgtgatcttaaaaattggagagaggctttagctgcagtattgacttatgca
aagccggatgaattttcagccctttgtgatcttttgggaaccaggcttgaaaatgaagga
gatagcctcctgcagactcaagcatgtctctgctatatttgtgcagggaatgtagagaaa
ttagttgcatgttggactaaagctcaagatggaagccaccctttgtcacttcaggatctg
attgagaaagttgtcatcctgcgaaaagctgtgcaactcactcaagccatggacactagt
actgtaggagttctcttggctgcgaagatgagtcagtatgccaatttgttggcagctcag
ggcagtattgctgcagccttggcttttcttcctgacaacaccaaccagccaaatatcatg
cagcttcgtgacagactttgtagagcacaaggagagcctgtagcaggacatgaatcacct
aaaattccgtacgagaaacagcagctccccaagggcaggcctggaccagttgctggccac
caccagatgccaagagttcaaactcaacaatattatccccatggagaaaatcctccacct
ccgggtttcataatgcatggaaatgttaatccaaatgctgctggtcagcttcccacatct
ccaggtcatatgcacacccaggtaccaccttatccacagccacagcgtcctcagaatggt
tggaatgaccctccagctttgaacagagtacccaaaaagaagaagatgcctgaaaacttc
atgcctcctgttcccatcacatcaccaatcatgaacccgttgggtgacccccagtcacaa
atgctgcagcaacagccttcagctccagtaccactgtcaagccagtcttcattcccacag
ccacatcttccaggtggccagcccttccatggcgtacagcaacctcttggtcaaacaggc
atgccaccatctttttcaaagcccaatattgaaggtgccccaggggctcctattggaaat
accttccagcatgtgcagtctttgccaacaaaaaaaattaccaagaaacctattccagat
gagcacctcattctaaagaccacatttgaggatcttattcagcgctgcctttcttcagca
acagaccctcaaaccaagaggaagctagatgatgccagcaaacgtttggagtttctgtat
gataaacttagggaacagacactttcaccaacaatcaccagtggtttacacaacattgca
aggagcattgaaactcgaaactactcagaaggattgaccatgcatacccacatagttagc
accagcaacttcagtgagacctctgctttcatgccagttctcaaagttgttctcacccag
gccaataagctgggtgtctaa

DBGET integrated database retrieval system