KEGG   Homo sapiens (human): 22885Help
Entry
22885             CDS       T01001                                 

Gene name
ABLIM3
Definition
actin binding LIM protein family, member 3
Orthology
K07520  
actin-binding LIM protein
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    22885 (ABLIM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q32
AA seq 683 aa AA seqDB search
MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSG
FFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDK
VTFSGKECVCQTCSQSMASSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQT
CSVILTGEYISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCH
QMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICAKVD
NEILNYKDLAALPKVKSIYEVQRPDLISYEPHSRYMSDEMLERCGYGESLGTLSPYSQDI
YENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSS
TPTSYQAPKHFHIPAGDSNIYRKPPIYKRHGDLSTATKSKTSEDISQTSKYSPIYSPDPY
YASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYAD
PWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSA
DLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLERHLSQEEFYQVFGM
TISEFDRLALWKRNELKKQARLF
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaacactagcattccttatcagcagaatccttacaatccacggggcagctccaatgtc
atccagtgctaccgctgtggagacacctgcaaaggggaagtggtccgcgtgcacaacaac
cacttccacatcagatgcttcacctgtcaagtatgtggctgtggcctggcccagtcaggc
ttcttcttcaagaaccaggagtacatctgcacccaggactaccagcaactctatggcacc
cgctgtgacagctgccgggacttcatcacaggcgaagtcatctcggccctgggccgcact
taccaccccaagtgcttcgtgtgcagcttgtgcaggaagcctttccccattggagacaag
gtgaccttcagcggtaaagaatgtgtgtgccaaacgtgctcccagtccatggccagcagt
aagcccatcaagattcgtggaccaagccactgtgccgggtgcaaggaggagatcaagcac
ggccagtcactcctggctctggacaagcagtggcacgtcagctgcttcaagtgccagacc
tgcagcgtcatcctcaccggggagtatatcagcaaggatggtgttccatactgtgagtcc
gactaccatgcccagtttggcattaaatgtgagacttgtgaccgatacatcagtggcaga
gtcttggaggcaggagggaagcactaccacccaacctgtgccaggtgtgtacgctgccac
cagatgttcaccgaaggagaggaaatgtacctcacaggttccgaggtttggcaccccatc
tgcaaacaggcagcccgggcagagaagaagttaaagcatagacggacatctgaaacctcc
atctcaccccctggatccagcattgggtcacccaaccgagtcatctgcgctaaagtggat
aatgagatccttaattacaaagacctggcggctctccccaaggttaagtctatctacgag
gtacaacgccccgacctcatttcctatgagcctcattccagatacatgtccgacgagatg
ctggagagatgtggctatggagagtcgctgggaacattatctccctactcccaggacatc
tacgagaacctggacctccggcagagacgggcctccagcccggggtacatagactccccc
acctacagccggcagggcatgtcccccaccttctcccgctcacctcaccactactaccgc
tctgggcccgagagtggccggagctctccataccatagccagttagatgtgaggtcctcc
actccaacctcttaccaggctcccaagcactttcacatcccagctggagacagtaacatc
taccggaaacccccgatctacaaacggcatggtgatttgtctacagcaaccaagagcaaa
acaagtgaagacatcagccagacctccaagtacagtcccatctactcgccagacccctac
tatgcttcggagtctgagtactggacctaccatgggtcccccaaagtgccccgagccaga
aggttctcgtctggaggagaggaggatgattttgaccgcagcatgcacaagctccaaagt
ggaattggccggctgattctgaaggaagaaatgaaggcccggtcgagctcctatgcagat
ccctggacccctccccggagctccaccagcagccgggaagccctgcacacagctggctat
gagatgtccctcaatggctcccctcggtcgcactacctggctgacagtgatcctctcatc
tccaaatctgcctccctgcctgcctaccgaagaaatgggctgcacaggacacccagcgca
gacctcttccactacgacagcatgaacgcagtcaactggggcatgcgagagtacaagatc
tacccttatgaactgctgctggtgactacaagaggaagaaaccgactgcccaaggatgta
gacaggacccgtttagagcgccacctgtcccaggaagagttctaccaagtctttggcatg
accatctctgagtttgaccggctggccctctggaagaggaatgaactgaagaagcaagcc
cggctgttctag

DBGET integrated database retrieval system