KEGG   Homo sapiens (human): 22888Help
Entry
22888             CDS       T01001                                 

Gene name
UBOX5, RNF37, UBCE7IP5, UIP5
Definition
U-box domain containing 5
Orthology
K10600  
U-box domain-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    22888 (UBOX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p13
AA seq 512 aa AA seqDB search
MVINLCLPQFRPRIHCNKISADGYEVENLISEDLTKRSHGFRTEYFIKPPVYVTVSFPFN
VEICRINIDLTAGGGQNVTGLEMYTSASSSRVSWNTPQCRTLGPAEPSVPDKEAFTLVGK
VLLKNQSQVVFSHRGFKARPPFGAMEATLPSPAVVAQELWNKGALSLSHVAHLRICITHV
TGGGIPCIKRLEVWGQPAKTCSQEVIDSILLVTSENLPQDVALQAPALPMESDCDPGDQP
ESQQAPSSLQKLAEIIQDVPEEFLDPITLEIMPCPMLLPSGKVIDQSTLEKCNRSEATWG
RVPSDPFTGVAFTPHSQPLPHPSLKARIDHFLLQHSIPGCHLLGRAQTALAVIPSSIVLP
SQKRKIEQAEHVPDSNFGVNASCFSATSPLVLPTTSEHTAKKMKATNEPSLTHMDCSTGP
LSHEQKLSQSLEIALASTLGSMPSFTARLTRGQLQHLGTRGSNTSWRPGTGSAWEHPGPR
MCLLQKSIFSLLQKGAGVPAALRPPPVPTLPG
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggtaataaatctttgcctcccacagttcagaccaagaattcactgcaacaagatatca
gctgatggttacgaagtagaaaatctcatctctgaagatctcacaaagagaagtcatggt
ttcaggacagagtatttcattaagccaccagtctatgtgacagtttcatttccctttaat
gtggaaatctgtaggatcaacatagacctcacagctgggggaggtcagaacgtcactggc
ctggaaatgtacacatctgcctcatctagcagagtgtcttggaatacgccccagtgccgg
accctgggcccagctgagccatctgtcccagacaaggaggcgttcaccttggtaggcaaa
gtcttactgaaaaaccagagccaagtggtgtttagccacaggggcttcaaggccaggccc
ccttttggcgcgatggaagccacactcccctcccctgctgttgtggcccaggagctctgg
aataaaggggctctttcccttagccacgtggcccacttaaggatctgtatcacccatgtg
acaggcggcggtatcccttgtatcaagcggttggaagtgtggggtcagccggccaagacc
tgctcccaggaagtgatagacagcatcctgctggtcacctcagagaacctgcctcaggat
gtggctctgcaggctccagccttgcccatggaaagtgactgtgaccctggggaccagcct
gagagccagcaggctccctccagcctgcagaagctggccgagatcattcaggatgtgcct
gaggagttcctggatcccatcaccctggagatcatgccttgtcccatgctgctgccctca
ggcaaggtcatcgaccagagcacactggagaagtgtaaccgcagtgaagccacatggggc
cgagtgcccagtgaccctttcacgggggtagcttttactccgcactctcagcccctgcct
cacccctccctcaaggcccggattgaccatttcctgctccagcactccatccctggctgc
cacctgcttgggagagcacagacggcattggcagtgatcccttcttccattgttctgccc
tctcagaaaaggaagatagagcaggctgaacatgtcccagacagtaactttggtgtaaat
gcttcctgtttttctgccacaagccctttggtcttacccactacctcagagcacactgct
aagaaaatgaaagccaccaatgagcccagcctgacacatatggactgctcgacaggtcca
ctgtcccacgagcagaagctgtcacaaagcttggaaattgccttggcatccacccttggc
tctatgccctccttcacggcacggctgaccaggggacagctccagcaccttggcacaaga
gggagcaacacttcctggaggcctggcaccggctcggcctgggagcatcctgggccccga
atgtgcctcctgcaaaagagtattttctccctacttcaaaaaggagccggtgtaccagct
gccctgcggccacctcctgtgccgaccctgcctgggtga

DBGET integrated database retrieval system