KEGG   Homo sapiens (human): 2289Help
Entry
2289              CDS       T01001                                 

Gene name
FKBP5, AIG6, FKBP51, FKBP54, P54, PPIase, Ptg-10
Definition
(RefSeq) FK506 binding protein 5 (EC:5.2.1.8)
  KO
K09571  
FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    2289 (FKBP5)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     2289 (FKBP5)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    2289 (FKBP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.31
AA seq 457 aa AA seqDB search
MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRM
FDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAE
LIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD
AKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgactactgatgaaggtgccaagaacaatgaagaaagccccacagccactgttgctgag
cagggagaggatattacctccaaaaaagacaggggagtattaaagattgtcaaaagagtg
gggaatggtgaggaaacgccgatgattggagacaaagtttatgtccattacaaaggaaaa
ttgtcaaatggaaagaagtttgattccagtcatgatagaaatgaaccatttgtctttagt
cttggcaaaggccaagtcatcaaggcatgggacattggggtggctaccatgaagaaagga
gagatatgccatttactgtgcaaaccagaatatgcatatggctcggctggcagtctccct
aaaattccctcgaatgcaactctcttttttgagattgagctccttgatttcaaaggagag
gatttatttgaagatggaggcattatccggagaaccaaacggaaaggagagggatattca
aatccaaacgaaggagcaacagtagaaatccacctggaaggccgctgtggtggaaggatg
tttgactgcagagatgtggcattcactgtgggcgaaggagaagaccacgacattccaatt
ggaattgacaaagctctggagaaaatgcagcgggaagaacaatgtattttatatcttgga
ccaagatatggttttggagaggcagggaagcctaaatttggcattgaacctaatgctgag
cttatatatgaagttacacttaagagcttcgaaaaggccaaagaatcctgggagatggat
accaaagaaaaattggagcaggctgccattgtcaaagagaagggaaccgtatacttcaag
ggaggcaaatacatgcaggcggtgattcagtatgggaagatagtgtcctggttagagatg
gaatatggtttatcagaaaaggaatcgaaagcttctgaatcatttctccttgctgccttt
ctgaacctggccatgtgctacctgaagcttagagaatacaccaaagctgttgaatgctgt
gacaaggcccttggactggacagtgccaatgagaaaggcttgtataggaggggtgaagcc
cagctgctcatgaacgagtttgagtcagccaagggtgactttgagaaagtgctggaagta
aacccccagaataaggctgcaagactgcagatctccatgtgccagaaaaaggccaaggag
cacaacgagcgggaccgcaggatatacgccaacatgttcaagaagtttgcagagcaggat
gccaaggaagaggccaataaagcaatgggcaagaagacttcagaaggggtcactaatgaa
aaaggaacagacagtcaagcaatggaagaagagaaacctgagggccacgtatga

DBGET integrated database retrieval system