KEGG   Homo sapiens (human): 22894Help
Entry
22894             CDS       T01001                                 

Gene name
DIS3, 2810028N01Rik, EXOSC11, KIAA1008, RRP44, dis3p
Definition
DIS3 mitotic control homolog (S. cerevisiae)
Orthology
K12585  
exosome complex exonuclease DIS3/RRP44 [EC:3.1.13.-]
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Module
Exosome, eukaryotes
Class
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:hsa03018]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q22.1
AA seq 928 aa AA seqDB search
MLKSKTFLKKTRAGGVMKIVREHYLRDDIGCGAPGCAACGGAHEGPALEPQPQDPASSVC
PQPHYLLPDTNVLLHQIVSAWRPGTWASVASSLRLPGSLETYVEQEQGENANDRNDRAIR
VAAKWYNEHLKKMSADNQLQVIFITNDRRNKEKAIEEGIPAFTCEEYVKSLTANPELIDR
LACLSEEGNEIESGKIIFSEHLPLSKLQQGIKSGTYLQGTFRASRENYLEATVWIHGDNE
ENKEIILQGLKHLNRAVHEDIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERML
KTAVSEKMLKPTGRVVGIIKRNWRPYCGMLSKSDIKESRRHLFTPADKRIPRIRIETRQA
STLEGRRIIVAIDGWPRNSRYPNGHFVRNLGDVGEKETETEVLLLEHDVPHQPFSQAVLS
FLPKMPWSITEKDMKNREDLRHLCICSVDPPGCTDIDDALHCRELENGNLEVGVHIADVS
HFIRPGNALDQESARRGTTVYLCEKRIDMVPELLSSNLCSLKCDVDRLAFSCIWEMNHNA
EILKTKFTKSVINSKASLTYAEAQLRIDSANMNDDITTSLRGLNKLAKILKKRRIEKGAL
TLSSPEVRFHMDSETHDPIDLQTKELRETNSMVEEFMLLANISVAKKIHEEFSEHALLRK
HPAPPPSNYEILVKAARSRNLEIKTDTAKSLAESLDQAESPTFPYLNTLLRILATRCMMQ
AVYFCSGMDNDFHHYGLASPIYTHFTSPIRRYADVIVHRLLAVAIGADCTYPELTDKHKL
ADICKNLNFRHKMAQYAQRASVAFHTQLFFKSKGIVSEEAYILFVRKNAIVVLIPKYGLE
GTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEP
QIPGISIPTDTSNMDLNGPKKKKMKLGK
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagtccaagacgttcttaaaaaagacccgggcgggcggcgtgatgaagatcgtg
cgcgagcactacctgcgagacgacatcggctgcggtgcgcccgggtgcgcagcgtgtgga
ggggcgcacgaggggccggccctggagccgcagccccaggacccggcgagcagcgtctgc
ccgcaaccgcactacttgctgcccgacactaatgtgttactgcaccagattgtaagtgcc
tggaggccggggacctgggcttctgtggcctccagcctgcgactcccaggcagcttagaa
acctatgtagaacaagaacagggagaaaatgctaatgacaggaatgatagagcgattcga
gtagcagcaaaatggtacaatgaacatttgaaaaaaatgtcagcagacaaccagctgcaa
gttatcttcataacaaatgacaggagaaacaaagagaaagccatagaagaaggaatacca
gctttcacttgtgaagaatatgtaaagagcctaactgctaaccccgaactcatagatcgt
cttgcttgtttgtctgaagaagggaatgaaatagaaagtggaaaaataatattttcagag
catcttcccttaagtaagctacagcaaggcataaaatctggtacataccttcaaggaaca
tttagagctagcagggaaaattacttggaagctacagtatggattcatggcgacaatgaa
gaaaataaagagataatcttacagggacttaaacatttaaacagagctgttcacgaagat
attgtggctgtggagcttctccccaagagtcagtgggtagcaccatcttctgtggtttta
catgatgaaggtcaaaatgaagaagatgtggagaaagaagaagagacagaacgaatgctt
aagactgctgtaagcgagaaaatgttgaagcctacaggtagagttgtaggaataataaaa
aggaattggagaccatattgtggcatgctttccaagtctgacattaaggagtcaagaaga
catctctttacacctgctgataagagaatccctcgaattcgcatagaaaccagacaggct
tccacattagaaggacggagaattattgttgctattgatggttggcccagaaattccaga
tatccaaatggacactttgtgagaaatttaggtgatgttggagagaaagagactgaaaca
gaagttttgttacttgaacacgatgttccccatcagcctttttcacaggctgttcttagt
tttctgccaaagatgccctggagcattactgaaaaggacatgaaaaaccgagaagacctg
aggcatctgtgtatttgtagtgtagacccaccaggatgtactgatatagacgatgctcta
cattgtcgagaactcgaaaatggaaatttggaggttggtgttcatattgctgatgtgagc
cattttattaggccaggaaatgccttggatcaagaatcagccagaagaggaacaactgtg
tatctttgtgaaaagaggattgacatggttccagagttgcttagctctaacttgtgttcc
ttaaaatgtgacgtggacaggctggcattttcatgtatttgggaaatgaatcacaatgct
gaaatcttaaaaacgaagtttaccaaaagtgttattaattcaaaggcatctctgacgtat
gctgaagctcagttgagaattgattcagcaaacatgaatgatgatattaccactagtctc
cgtggactgaataaactagccaaaattctgaagaaaagaaggattgaaaaaggggctttg
actctatcctctcctgaagttcgattccacatggacagtgaaactcacgatcctatagat
ctgcagaccaaggaacttagggaaacaaattccatggttgaagaatttatgttacttgcc
aatatttctgttgcaaaaaaaattcatgaggaattttctgaacatgctctgcttcgaaaa
catcctgctccacctccatcaaattatgaaattcttgttaaggcagccaggtcaaggaat
ttggaaattaagactgatacagccaagtctttggctgagtctttggatcaggccgaatct
cctacttttccatatctaaacactctgttgagaatattagccactcgctgtatgatgcaa
gctgtgtacttctgttctggaatggataatgattttcatcactatggcttagcgtctcca
atatacacacattttacttcacccattagaagatacgcagatgtcattgttcatcggctt
ttggctgtggctattggggctgactgtacttatccagagttgacagacaaacacaagctt
gcagatatatgtaaaaatctaaatttccggcacaaaatggctcaatatgcccaacgtgca
tcagtggcttttcatacccagttattcttcaaaagcaaaggaatagtaagtgaagaagcc
tatattttatttgtaagaaagaatgccattgtggtattaattccaaagtatggtttagaa
gggacagtcttttttgaagaaaaggacaaaccaaacccacagcttatttatgatgatgag
ataccctcacttaaaatagaagatacagtgttccatgtatttgataaagttaaagtgaaa
atcatgttagactcatctaatcttcaacatcagaagatccgaatgtccctggtagaacca
cagataccaggaataagcattcctactgatacttcaaacatggaccttaatggaccaaag
aaaaagaagatgaagcttggaaaatag

DBGET integrated database retrieval system