KEGG   Homo sapiens (human): 229Help
Entry
229               CDS       T01001                                 

Gene name
ALDOB, ALDB, ALDO2
Definition
aldolase B, fructose-bisphosphate (EC:4.1.2.13)
Orthology
K01623  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Disease
H00071  
Hereditary fructose intolerance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    229 (ALDOB)
   01230 Biosynthesis of amino acids
    229 (ALDOB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    229 (ALDOB)
   00030 Pentose phosphate pathway
    229 (ALDOB)
   00051 Fructose and mannose metabolism
    229 (ALDOB)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     229 (ALDOB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   229 (ALDOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q21.3-q22.2
AA seq 364 aa AA seqDB search
MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR
EILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTN
KETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQ
NGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHAC
TKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSF
SYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTA
CYTY
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcccaccgatttccagccctcacccaggagcagaagaaggagctctcagaaattgcc
cagagcattgttgccaatggaaaggggatcctggctgcagatgaatctgtaggtaccatg
gggaaccgcctgcagaggatcaaggtggaaaacactgaagagaaccgccggcagttccga
gaaatcctcttctctgtggacagttccatcaaccagagcatcgggggtgtgatccttttc
cacgagaccctctaccagaaggacagccagggaaagctgttcagaaacatcctcaaggaa
aaggggatcgtggtgggaatcaagttagaccaaggaggtgctcctcttgcaggaacaaac
aaagaaaccaccattcaagggcttgatggcctctcagagcgctgtgctcagtacaagaaa
gatggtgttgactttgggaagtggcgtgctgtgctgaggattgccgaccagtgtccatcc
agcctcgctatccaggaaaacgccaacgccctggctcgctacgccagcatctgtcagcag
aatggactggtacctattgttgaaccagaggtaattcctgatggagaccatgacctggaa
cactgccagtatgttactgagaaggtcctggctgctgtctacaaggccctgaatgaccat
catgtttacctggagggcaccctgctaaagcccaacatggtgactgctggacatgcctgc
accaagaagtatactccagaacaagtagctatggccaccgtaacagctctccaccgtact
gttcctgcagctgttcctggcatctgctttttgtctggtggcatgagtgaagaggatgcc
actctcaacctcaatgctatcaacctttgccctctaccaaagccctggaaactaagtttc
tcttatggacgggccctgcaggccagtgcactggctgcctggggtggcaaggctgcaaac
aaggaggcaacccaggaggcttttatgaagcgggccatggctaactgccaggcggccaaa
ggacagtatgttcacacgggttcttctggggctgcttccacccagtcgctcttcacagcc
tgctatacctactag

DBGET integrated database retrieval system