KEGG   Homo sapiens (human): 22900Help
Entry
22900             CDS       T01001                                 

Gene name
CARD8, CARDINAL, DACAR, DAKAR, NDPP, NDPP1, TUCAN
Definition
(RefSeq) caspase recruitment domain family member 8
  KO
K12801  
caspase recruitment domain-containing protein 8
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    22900 (CARD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y2G2(Tbio)
UniProt: 
Position
19q13.33
AA seq 392 aa AA seqDB search
MEKKECPEKSSSSEEELPRRDSGSSRNIDASKLIRLQGSRKLLVDNSIRELQYTKTGIFF
QAEACVTNDTVYRELPCVSETLCDISHFFQEDDETEAEPLLFRAVPECQLSGGDIPSVSE
EQESSEGQDSGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELIDKSTNRY
SVWFPTAGWYLWSATGLGFLVRDEVTVTIAFGSWSQHLALDLQHHEQWLVGGPLFDVTAE
PEEAVAEIHLPHFISLQAGEVDVSWFLVAHFKNEGMVLEHPARVEPFYAVLESPSFSLMG
ILLRIASGTRLSIPITSNTLIYYHPHPEDIKFHLYLVPSDALLTKAIDDEEDRFHGVRLQ
TSPPMEPLNFGSSYIVSNSANLKVMPKWISSL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaggagtgtccagaaaagagtagcagcagtgaggaagagctgccgagacgg
gacagtggatccagtaggaacatagatgcatccaaactcattagactacaaggatcacgg
aaactgttggttgacaatagcatacgggaactgcaatacacaaaaactggaatttttttt
caggctgaggcctgtgtgacaaatgatacggtatacagggagctaccctgtgtttctgag
accctttgtgacatctcacattttttccaagaagatgatgagacagaggcagagccatta
ttgttccgtgctgttcctgagtgtcaactatctgggggggacattcccagtgtatcagaa
gagcaggaatcttcagagggacaagattcaggagacatttgctcagaagagaatcaaata
gtttcctcttatgcttctaaagtctgttttgagatcgaagaagattataaaaatcgtcag
tttctggggcctgaaggaaatgtggatgttgagttgattgataagagcacaaacagatac
agcgtttggttccccactgctggctggtatctgtggtcagccacaggcctcggcttcctg
gtaagggatgaggtcacagtgacgattgcgtttggttcctggagtcagcacctggccctg
gacctgcagcaccatgaacagtggctggtgggcggccccttgtttgatgtcactgcagag
ccagaggaggctgtcgccgaaatccacctcccccacttcatctccctccaagcaggtgag
gtggacgtctcctggtttctcgttgcccattttaagaatgaagggatggtcctggagcat
ccagcccgggtggagcctttctatgctgtcctggaaagccccagcttctctctgatgggc
atcctgctgcggatcgccagtgggactcgcctctccatccccatcacttccaacacattg
atctattatcacccccaccccgaagatattaagttccacttgtaccttgtccccagcgac
gccttgctaacaaaggcgatagatgatgaggaagatcgcttccatggtgtgcgcctgcag
acttcgcccccaatggaacccctgaactttggttccagttatattgtgtctaattctgct
aacctgaaagtaatgcccaagtggatctccagcttgtag

DBGET integrated database retrieval system