KEGG   Homo sapiens (human): 22901Help
Entry
22901             CDS       T01001                                 

Gene name
ARSG
Definition
arylsulfatase G
Orthology
K12381  
arylsulfatase G [EC:3.1.6.-]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    22901 (ARSG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.-  
     22901 (ARSG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
17q24.2
AA seq 525 aa AA seqDB search
MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKD
TANLDKMASEGMRFVDFHAAASTCSPSRASLLTGRLGLRNGVTRNFAVTSVGGLPLNETT
LAEVLQQAGYVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPA
CPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRP
FLLYVALAHMHVPLPVTQLPAAPRGRSLYGAGLWEMDSLVGQIKDKVDHTVKENTFLWFT
GDNGPWAQKCELAGSVGPFTGFWQTRQGGSPAKQTTWEGGHRVPALAYWPGRVPVNVTST
ALLSVLDIFPTVVALAQASLPQGRRFDGVDVSEVLFGRSQPGHRVLFHPNSGAAGEFGAL
QTVRLERYKAFYITGGARACDGSTGPELQHKFPLIFNLEDDTAEAVPLERGGAEYQAVLP
EVRKVLADVLQDIANDNISSADYTQDPSVTPCCNPYQIACRCQAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgggctggctttttctaaaggttttgttggcgggagtgagtttctcaggatttctttat
cctcttgtggatttttgcatcagtgggaaaacaagaggacagaagccaaactttgtgatt
attttggccgatgacatggggtggggtgacctgggagcaaactgggcagaaacaaaggac
actgccaaccttgataagatggcttcggagggaatgaggtttgtggatttccatgcagct
gcctccacctgctcaccctcccgggcttccttgctcaccggccggcttggccttcgcaat
ggagtcacacgcaactttgcagtcacttctgtgggaggccttccgctcaacgagaccacc
ttggcagaggtgctgcagcaggcgggttacgtcactgggataataggcaaatggcatctt
ggacaccacggctcttatcaccccaacttccgtggttttgattactactttggaatccca
tatagccatgatatgggctgtactgatactccaggctacaaccaccctccttgtccagcg
tgtccacagggtgatggaccatcaaggaaccttcaaagagactgttacactgacgtggcc
ctccctctttatgaaaacctcaacattgtggagcagccggtgaacttgagcagccttgcc
cagaagtatgctgagaaagcaacccagttcatccagcgtgcaagcaccagcgggaggccc
ttcctgctctatgtggctctggcccacatgcacgtgcccttacctgtgactcagctacca
gcagcgccacggggcagaagcctgtatggtgcagggctctgggagatggacagtctggtg
ggccagatcaaggacaaagttgaccacacagtgaaggaaaacacattcctctggtttaca
ggagacaatggcccgtgggctcagaagtgtgagctagcgggcagtgtgggtcccttcact
ggattttggcaaactcgtcaagggggaagtccagccaagcagacgacctgggaaggaggg
caccgggtcccagcactggcttactggcctggcagagttccagttaatgtcaccagcact
gccttgttaagcgtgctggacatttttccaactgtggtagccctggcccaggccagctta
cctcaaggacggcgctttgatggtgtggacgtctccgaggtgctctttggccggtcacag
cctgggcacagggtgctgttccaccccaacagcggggcagctggagagtttggagccctg
cagactgtccgcctggagcgttacaaggccttctacattaccggtggagccagggcgtgt
gatgggagcacggggcctgagctgcagcataagtttcctctgattttcaacctggaagac
gataccgcagaagctgtgcccctagaaagaggtggtgcggagtaccaggctgtgctgccc
gaggtcagaaaggttcttgcagacgtcctccaagacattgccaacgacaacatctccagc
gcagattacactcaggacccttcagtaactccctgctgtaatccctaccaaattgcctgc
cgctgtcaagccgcataa

DBGET integrated database retrieval system