KEGG   Homo sapiens (human): 22913Help
Entry
22913             CDS       T01001                                 

Gene name
RALY, HNRPCL2, P542
Definition
(RefSeq) RALY heterogeneous nuclear ribonucleoprotein
  KO
K12895  
heterogeneous nuclear ribonucleoprotein C-like 2
Organism
hsa  Homo sapiens (human)
Brite
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    22913 (RALY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.21-q11.23
AA seq 306 aa AA seqDB search
MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFV
QYSNERHARAAVLGENGRVLAGQTLDINMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYR
DDFYDRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKI
KLKSSELQAIKTELTQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGGGAGGGGGGGGSG
GGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEARTRDDGDEEGLLTHSEEELEHSQDTDA
DDGALQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgaagcttcaggcaagcaatgtaaccaacaagaatgaccccaagtccatcaac
tctcgagtcttcattggaaacctcaacacagctctggtgaagaaatcagatgtggagacc
atcttctctaagtatggccgtgtggccggctgttctgtgcacaagggctatgcctttgtt
cagtactccaatgagcgccatgcccgggcagctgtgctgggagagaatgggcgggtgctg
gccgggcagaccctggacatcaacatggctggagagcctaagcctgacagacccaagggg
ctaaagagagcagcatctgccatatacagtggctacatctttgactatgattactaccgg
gacgacttctacgacaggctcttcgactaccggggccgtctgtcgcccgtgccagtgccc
agggcggtccctgtgaagcgaccccgggtcacagtccctttggtccggcgtgtcaaaact
aacgtacctgtcaagctctttgcccgctccacagctgtcaccaccagctcagccaagatc
aagttaaagagcagtgagctgcaggccatcaagacggagctgacacagatcaagtccaat
atcgatgccctgctgagccgcttggagcagatcgctgcggagcaaaaggccaatccagat
ggcaagaagaagggtgatggaggtggcgccggcggcggcggcggtggtggtggcagcggt
ggcggtggcagtggtggtggcggtggcggtggcagcagccggccaccagccccccaagag
aacacaacttctgaggcaggcctgccccagggggaagcacggacccgagacgacggcgat
gaggaagggctcctgacacacagcgaggaagagctggaacacagccaggacacagacgcg
gatgatggggccttgcagtaa

DBGET integrated database retrieval system