KEGG   Homo sapiens (human): 22916Help
Entry
22916             CDS       T01001                                 

Gene name
NCBP2, CBC2, CBP20, NIP1, PIG55
Definition
(RefSeq) nuclear cap binding protein subunit 2
  KO
K12883  
nuclear cap-binding protein subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Spliceosome
Module
Cap binding complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    22916 (NCBP2)
  Translation
   03013 RNA transport
    22916 (NCBP2)
   03015 mRNA surveillance pathway
    22916 (NCBP2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Cap binding complex
     22916 (NCBP2)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    22916 (NCBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q29
AA seq 156 aa AA seqDB search
MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELF
SKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFK
EGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtggcctcctgaaggcgctgcgcagcgactcctacgtggagctgagccagtac
cgggaccagcacttccggggtgacaatgaagaacaagaaaaattactgaagaaaagctgt
acgttatatgttggaaatctttctttttacacaactgaagaacaaatctatgaactcttc
agcaaaagtggtgacataaagaaaatcattatgggtctggataaaatgaagaaaacagca
tgtggattctgttttgtggaatattactcacgcgcagatgcggaaaacgccatgcggtac
ataaatgggacgcgtctggatgaccgaatcattcgcacagactgggacgcaggctttaag
gagggcaggcaatacggccgtgggcgatctgggggccaggttcgggatgagtatcggcag
gactacgatgctgggagaggaggctatggaaaactggcacagaaccagtga

DBGET integrated database retrieval system