KEGG   Homo sapiens (human): 22925Help
Entry
22925             CDS       T01001                                 

Gene name
PLA2R1, CLEC13C, PLA2-R, PLA2G1R, PLA2IR, PLA2R
Definition
(RefSeq) phospholipase A2 receptor 1
  KO
K06560  
mannose receptor, C type
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    22925 (PLA2R1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    22925 (PLA2R1)
Cellular antigens [BR:hsa04090]
 Proteins
  22925 (PLA2R1)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 6: Mannose receptor family
   22925 (PLA2R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q23-q24
AA seq 1463 aa AA seqDB search
MLLSPSLLLLLLLGAPRGCAEGVAAALTPERLLEWQDKGIFVIQSESLKKCIQAGKSVLT
LENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSAPEQPLSLYECDSTLVSLRWRCNRK
MITGPLQYSVQVAHDNTVVASRKYIHKWISYGSGGGDICEYLHKDLHTIKGNTHGMPCMF
PFQYNHQWHHECTREGREDDLLWCATTSRYERDEKWGFCPDPTSAEVGCDTIWEKDLNSH
ICYQFNLLSSLSWSEAHSSCQMQGGTLLSITDETEENFIREHMSSKTVEVWMGLNQLDEH
AGWQWSDGTPLNYLNWSPEVNFEPFVEDHCGTFSSFMPSAWRSRDCESTLPYICKKYLNH
IDHEIVEKDAWKYYATHCEPGWNPYNRNCYKLQKEEKTWHEALRSCQADNSALIDITSLA
EVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVS
AEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKIDTVLRSFDQAS
SGYYCPPALVTITNRFEQAFITSLISSVVKMKDSYFWIALQDQNDTGEYTWKPVGQKPEP
VQYTHWNTHQPRYSGGCVAMRGRHPLGRWEVKHCRHFKAMSLCKQPVENQEKAEYEERWP
FHPCYLDWESEPGLASCFKVFHSEKVLMKRTWREAEAFCEEFGAHLASFAHIEEENFVNE
LLHSKFNWTEERQFWIGFNKRNPLNAGSWEWSDRTPVVSSFLDNTYFGEDARNCAVYKAN
KTLLPLHCGSKREWICKIPRDVKPKIPFWYQYDVPWLFYQDAEYLFHTFASEWLNFEFVC
SWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEERANDEFRWRDGTPVIYQNWD
TGRERTVNNQSQRCGFISSITGLWGSEECSVSMPSICKRKKVWLIEKKKDTPKQHGTCPK
GWLYFNYKCLLLNIPKDPSSWKNWTHAQHFCAEEGGTLVAIESEVEQAFITMNLFGQTTS
VWIGLQNDDYETWLNGKPVVYSNWSPFDIINIPSHNTTEVQKHIPLCALLSSNPNFHFTG
KWYFEDCGKEGYGFVCEKMQDTSGHGVNTSDMYPMPNTLEYGNRTYKIINANMTWYAAIK
TCLMHKAQLVSITDQYHQSFLTVVLNRLGYAHWIGLFTTDNGLNFDWSDGTKSSFTFWKD
EESSLLGDCVFADSNGRWHSTACESFLQGAICHVPPETRQSEHPELCSETSIPWIKFKSN
CYSFSTVLDSMSFEAAHEFCKKEGSNLLTIKDEAENAFLLEELFAFGSSVQMVWLNAQFD
GNNETIKWFDGTPTDQSNWGIRKPDTDYFKPHHCVALRIPEGLWQLSPCQEKKGFICKME
ADIHTAEALPEKGPSHSIIPLAVVLTLIVIVAICTLSFCIYKHNGGFFRRLAGFRNPYYP
ATNFSTVYLEENILISDLEKSDQ
NT seq 4392 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgtcgccgtcgctgctgctgctgctgctgctgggggcgccgcggggctgcgcc
gagggtgtggcggcggcgcttacccccgagcggctcctggagtggcaggataaaggaata
tttgttatccaaagtgagagtctcaagaaatgcattcaagcaggtaaatcggttctgacc
ctggagaactgcaagcaagcaaacaagcacatgctgtggaaatgggtttcaaaccatggc
ctctttaacataggaggcagtggttgcctgggcctgaatttctccgccccagagcagcca
ttaagcttatatgaatgtgactccaccctcgtttccttacggtggcgctgtaacaggaag
atgatcacaggcccgctgcagtactctgtccaggtggcgcatgacaacacagtggtggcc
tcacggaagtatattcataagtggatttcttatgggtcaggtggtggagacatttgtgaa
tatctacacaaagatttgcatacaatcaaagggaacacccacgggatgccgtgtatgttt
cccttccagtataaccatcagtggcatcatgaatgtacccgtgaaggtcgggaagatgac
ttactgtggtgtgccacgacaagccgttatgaaagagatgaaaagtggggattttgccct
gatcccacctctgcagaagtaggttgtgatactatttgggagaaggacctcaattcacac
atttgctaccagttcaacctgctttcatctctctcttggagtgaggcacattcttcatgc
cagatgcaaggaggtacgctgttaagtattacagatgaaactgaagaaaatttcataagg
gagcacatgagcagtaaaacagtggaggtgtggatgggcctcaatcagctggatgaacac
gctggctggcagtggtctgatggaacgccgctcaactatctgaattggagcccagaggta
aattttgagccatttgttgaagatcactgtggaacatttagttcatttatgccaagtgcc
tggaggagtcgggattgtgagtccaccttgccatatatatgtaaaaaatatctaaaccac
attgatcatgaaatagttgaaaaagatgcgtggaaatattatgctacccactgtgagcct
ggctggaatccctacaatcgtaattgctacaaacttcagaaagaagaaaagacctggcat
gaggctctgcgttcttgtcaggctgataacagtgcattaatagacataacctcattagca
gaggtggagtttcttgtaaccctccttggagatgaaaatgcatcagaaacatggattggt
ttgagcagcaataaaattccagtttcctttgaatggtctaatgactcttcagtcatcttt
actaattggcacacacttgagccccacatttttccaaatagaagccagctgtgtgtctca
gcagagcagtctgagggacactggaaagtcaaaaattgtgaagaaagacttttttacatt
tgtaaaaaagcaggccatgtcctctctgatgctgaatcaggatgtcaagagggatgggag
agacatggtggattctgttacaaaattgacacagtccttcgaagctttgaccaagcttcc
agcggttattactgtcctcctgcacttgtaaccattacaaacaggtttgaacaggctttt
attaccagtttgatcagtagtgtggtaaaaatgaaggacagttatttttggatagctctt
caggaccaaaatgatacgggagaatacacttggaagccagtagggcagaaacccgagccg
gtgcagtacacacactggaacacacaccagccgcgctacagtggtggctgtgttgccatg
cgaggaaggcatccacttggtcgctgggaagtgaagcactgtcggcactttaaggcaatg
tccttgtgcaagcagccagttgaaaatcaggaaaaagcagagtatgaagagagatggccc
tttcacccctgctatttggactgggagtcagagcctggtctggccagttgcttcaaggta
tttcatagtgaaaaagttctgatgaaaagaacatggagagaagctgaagcattttgcgaa
gaatttggagctcatcttgcaagctttgcccatattgaggaagagaattttgtgaatgag
ctcttacattcaaaatttaattggacagaagaaaggcagttctggattggatttaataaa
agaaacccactgaatgccggctcatgggagtggtctgatagaactcctgttgtctcttcg
tttttagacaacacttattttggagaagatgcaagaaactgtgctgtttataaggcaaac
aaaacattgctgcccttacactgtggttccaaacgtgaatggatatgcaaaatcccaaga
gatgtgaaacccaagattccgttctggtaccagtacgatgtaccctggctcttttatcag
gatgcagaatacctttttcatacctttgcctcagaatggttgaactttgagtttgtctgt
agctggctgcacagtgatcttctcacaattcattctgcacatgagcaagaattcatccac
agcaaaataaaagcgctatcaaagtatggtgcaagttggtggattggacttcaagaagaa
agagccaatgatgaatttcgctggagagatggaacaccagtgatataccagaactgggac
acaggaagagaaagaactgtgaataatcagagccagagatgtggctttatttcttctata
acaggactctggggtagtgaagagtgttcagtttctatgcctagtatctgtaagcgaaaa
aaggtttggctcatagagaaaaagaaagatacaccaaaacaacatggaacgtgtcccaaa
ggatggctatattttaactataagtgccttctgctgaatatccccaaagacccaagcagt
tggaagaactggacgcatgctcaacatttctgtgctgaagaaggggggaccctggtcgcc
attgaaagtgaggtggagcaagctttcattactatgaatctttttggccagaccaccagt
gtgtggataggtttacaaaatgatgattatgaaacatggctaaatggaaagcctgtggta
tattctaactggtctccatttgatataataaatattccaagtcacaataccactgaagtt
cagaaacacattcctctctgtgccttactctcaagtaatcctaattttcatttcactgga
aaatggtattttgaagactgtggaaaggaaggctatgggtttgtttgtgaaaaaatgcaa
gatacttctggacacggtgtaaatacatctgatatgtatccaatgcccaataccttagaa
tatggaaacagaacttacaaaataattaatgcaaatatgacttggtatgcagcaataaaa
acctgcctgatgcacaaagcacaactggtcagcatcacagaccagtatcaccagtccttc
ctcactgttgtcctcaaccggctaggatatgcccactggattggactgttcaccacagat
aatggtcttaattttgactggtctgatggcaccaaatcttctttcactttttggaaagat
gaggagtcctccctccttggtgactgcgtttttgccgacagcaacggacgctggcatagc
acagcctgcgagtcatttctgcaaggtgccatttgtcatgtgccacctgaaacaagacaa
tctgaacacccagagttgtgctcagaaacatctattccctggataaaatttaaaagtaat
tgctacagtttttctacagtcctagacagtatgagttttgaggctgctcatgaattttgc
aaaaaggaaggttctaatcttttaacaatcaaggatgaggctgaaaatgcatttctccta
gaagagctgtttgcttttggttcttctgtccagatggtttggttgaatgctcaatttgat
ggtaacaatgaaaccataaagtggtttgatggaactcccacagaccagtcaaactggggc
attcggaagccagacacagactacttcaagccccatcattgtgttgccttgaggatccct
gaaggattatggcagctatccccgtgtcaagaaaaaaaaggctttatatgtaaaatggag
gcagatattcacactgcagaggcgctgccagaaaaaggaccaagtcacagcatcattcct
cttgcggttgtactgacactgatagtcattgtggccatttgcacactttccttctgcata
tacaagcataacggtggcttcttcaggagacttgcagggtttcggaatccttactatcct
gcaaccaactttagtacagtatatttagaagaaaatattctcatttctgatcttgagaag
agtgaccaataa

DBGET integrated database retrieval system